PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_27588-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 114aa MW: 12636.5 Da PI: 9.0521 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 126 | 1.8e-39 | 1 | 100 | 2 | 101 |
DUF260 2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 C+aCk++rrkC+++C+lapyfpa++p +f+n h+lFG +n+l++l+++ +e+r+d m+s++yeA+ara+dPv Ga+g++++ q++l+ + ael+ TRIUR3_27588-P1 1 CSACKHQRRKCTPGCPLAPYFPADKPGSFRNSHRLFGIKNILRFLTRAGPEKRDDCMKSILYEADARASDPVLGAYGLLQSHQRELALATAELV 94 ********************************************************************************************** PP DUF260 96 llkeel 101 +lke+l TRIUR3_27588-P1 95 ALKEQL 100 *99985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 1.3E-36 | 1 | 97 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 23.971 | 1 | 100 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
CSACKHQRRK CTPGCPLAPY FPADKPGSFR NSHRLFGIKN ILRFLTRAGP EKRDDCMKSI 60 LYEADARASD PVLGAYGLLQ SHQRELALAT AELVALKEQL ELHGHAAQHR SAPD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-25 | 1 | 100 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-25 | 1 | 100 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015638299.1 | 4e-37 | LOB domain-containing protein 11 | ||||
TrEMBL | A0A3B6EG92 | 1e-77 | A0A3B6EG92_WHEAT; Uncharacterized protein | ||||
TrEMBL | T1NAQ7 | 2e-78 | T1NAQ7_TRIUA; Uncharacterized protein | ||||
STRING | TRIUR3_27588-P1 | 4e-79 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP15375 | 11 | 18 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13850.1 | 1e-27 | LOB domain-containing protein 22 |