PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_26867-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 220aa    MW: 24481.7 Da    PI: 7.5378
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_26867-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM122.73.2e-3833126195
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l+
  TRIUR3_26867-P1  33 LPPGFRFHPTDEELVVHYLKKKAAKVPLPV-TIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILA 125
                      79****************************.89***************988899**************************************98 PP

              NAM  95 k 95 
                      +
  TRIUR3_26867-P1 126 S 126
                      5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-4530144IPR003441NAC domain
PROSITE profilePS5100537.90733197IPR003441NAC domain
PfamPF023651.1E-1734127IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MGSSDSSSGS AQKAARHQHE PPPPRQRGSA PELPPGFRFH PTDEELVVHY LKKKAAKVPL  60
PVTIIAEVDL YKFDPWELPE KATFGEQEWY FFSPRDRKYP NGARPNRAAT SGYWKATGTD  120
KPILASGCGR EKLDDWVLCR IYKKINKAAA GDQQRSTECE DSVEDAVTAY PLYATAGMAG  180
AGKLHLDSYH MYKLSTDASL ITALIFQDVC REYIPTPSVM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-513314817169NO APICAL MERISTEM PROTEIN
1ut4_B2e-513314817169NO APICAL MERISTEM PROTEIN
1ut7_A2e-513314817169NO APICAL MERISTEM PROTEIN
1ut7_B2e-513314817169NO APICAL MERISTEM PROTEIN
4dul_A2e-513314817169NAC domain-containing protein 19
4dul_B2e-513314817169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-B2) and one extra pseudogene (NAM-B1) (PubMed:17124321). {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM8208860.0KM820886.1 Triticum aestivum cultivar Chinese Spring NAC transcription factor NAM-A1 (NAM-A1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020187501.11e-100NAC transcription factor NAM-A1
SwissprotA0SPJ31e-102NAMA1_TRITD; NAC transcription factor NAM-A1
TrEMBLM7YLQ21e-163M7YLQ2_TRIUA; NAC domain-containing protein 18
STRINGTRIUR3_26867-P11e-164(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.13e-62NAC domain containing protein 25
Publications ? help Back to Top
  1. Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J
    A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat.
    Science, 2006. 314(5803): p. 1298-301
    [PMID:17124321]