PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_25137-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 251aa    MW: 28011.9 Da    PI: 6.1734
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_25137-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM47.84.8e-151564252
              NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52
                     p+GfrFhPtd e+++ yL +kv +k ++   ++ evd++k+ePw+Lp+k+k
  TRIUR3_25137-P1 15 PQGFRFHPTDVEIITSYLVPKVLNKAFDP-IAVGEVDLNKCEPWELPEKAK 64
                     89************************999.78***************5433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-16565IPR003441NAC domain
PROSITE profilePS5100510.66614174IPR003441NAC domain
PfamPF023654.2E-61557IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MADHLQVQRQ QLKFPQGFRF HPTDVEIITS YLVPKVLNKA FDPIAVGEVD LNKCEPWELP  60
EKAKMGIFHK STGLKKVVMS SYAIPMPMSM GAEEQHGFLE SGTLPPFMGY GASSSLVPPS  120
SLPAYSSYQM HDTGARLSMM GTAVLLMMND HYFGNHHYQN MATPPRPLVS FYHHDHHQQQ  180
QQQQQQHMIQ MPMEMQIGAD EGLMIGVEPG SGPSSIVSQE DTLARLRSND VATTADEISS  240
VNMGTDGMWK Y
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167840.11e-94protein CUP-SHAPED COTYLEDON 2-like
TrEMBLM7Z5730.0M7Z573_TRIUA; NAC domain-containing protein 77
STRINGTRIUR3_25137-P10.0(Triticum urartu)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.24e-21Arabidopsis NAC domain containing protein 87