PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_24111-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 352aa    MW: 38860 Da    PI: 5.8903
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_24111-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.27.8e-54121421129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdee+v++yL++kv ++++++ +vi++vd++k ePw+Lp k+k +ekew+fF+++ +ky+tg+r+nratk+gyWkatgkdke+++
  TRIUR3_24111-P1  12 LPPGFRFHPTDEEVVTHYLTRKVLRESFSC-QVITDVDLNKNEPWELPGKAKMGEKEWFFFVHKGRKYPTGTRTNRATKKGYWKATGKDKEIFR 104
                      79****************************.99***************99999****************************************9 PP

              NAM  95 k...kgelvglkktLvfykgrapkgektdWvmheyrle 129
                          +  lvg+kktLvfy+grap+g kt Wvmheyrle
  TRIUR3_24111-P1 105 GkgrDAVLVGMKKTLVFYTGRAPSGGKTPWVMHEYRLE 142
                      84444445****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-617165IPR003441NAC domain
PROSITE profilePS5100557.78412165IPR003441NAC domain
PfamPF023653.2E-2813141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MSDVTAVMDL ALPPGFRFHP TDEEVVTHYL TRKVLRESFS CQVITDVDLN KNEPWELPGK  60
AKMGEKEWFF FVHKGRKYPT GTRTNRATKK GYWKATGKDK EIFRGKGRDA VLVGMKKTLV  120
FYTGRAPSGG KTPWVMHEYR LEGQLPHRLP HTAKDDWAVC RVFNKDSAAK NAPPQMAPAA  180
DGAMEDPLAF LDDLLIDTDL FDDADLPMLM DSPSGADDFA GASSSTSSAA LPLEPDAEHL  240
TIKTELPVLH PQQQQSPNYF FIPATANGNL GGAGYSPYQA MGDQQAAIRR YSKPKAEVAS  300
SSALLSPSLG LDTRALAGAD TSFLMPSSRS YLDLEELFRG EALMDYSDMW KI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-5411719174NAC domain-containing protein 19
3swm_B4e-5411719174NAC domain-containing protein 19
3swm_C4e-5411719174NAC domain-containing protein 19
3swm_D4e-5411719174NAC domain-containing protein 19
3swp_A4e-5411719174NAC domain-containing protein 19
3swp_B4e-5411719174NAC domain-containing protein 19
3swp_C4e-5411719174NAC domain-containing protein 19
3swp_D4e-5411719174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0108300.0AJ010830.1 Triticum sp. mRNA for GRAB2 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020182284.10.0NAC domain-containing protein 92-like
TrEMBLT1N1890.0T1N189_TRIUA; Uncharacterized protein
STRINGTRIUR3_24111-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.12e-79NAC domain containing protein 100