PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_20789-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 219aa    MW: 24585.8 Da    PI: 6.7025
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_20789-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  TRIUR3_20789-P1 14 RGLWSPEEDEKLMNHIAMYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding54.13.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  TRIUR3_20789-P1  67 RGTFSQEEEDLIIHLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                      899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.786961IPR017930Myb domain
SuperFamilySSF466894.12E-3011108IPR009057Homeodomain-like
SMARTSM007178.6E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001672.40E-111761No hitNo description
PROSITE profilePS5129426.98862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2665116IPR009057Homeodomain-like
SMARTSM007175.1E-1666114IPR001005SANT/Myb domain
PfamPF002493.7E-1667111IPR001005SANT/Myb domain
CDDcd001672.86E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MAKQSCCHKK RLRRGLWSPE EDEKLMNHIA MYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIH LHSMLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRERG  120
IDPATHKPLA EATTTSPTAC RAVFSDAELV PTTAALAQDQ LGPTDTISGH VDQYAGALGE  180
LRWSDYFDGA LQGQCVYDSG MVDDDAVQFD DVHGLSSWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3544390.0AK354439.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1007F18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557879.11e-110myb-related protein 308
SwissprotQ8VZQ21e-76MYB61_ARATH; Transcription factor MYB61
TrEMBLA0A3B6RH261e-164A0A3B6RH26_WHEAT; Uncharacterized protein
TrEMBLA0A446XKB01e-164A0A446XKB0_TRITD; Uncharacterized protein
TrEMBLM7ZT921e-164M7ZT92_TRIUA; Transcription factor MYB86
STRINGTRIUR3_20789-P11e-165(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.15e-79myb domain protein 61
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Matías-Hernández L, et al.
    AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.
    Plant J., 2017. 90(3): p. 520-534
    [PMID:28207974]