PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_20284-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 165aa    MW: 19042.8 Da    PI: 9.703
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_20284-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1721.9e-53191491129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdee+v++yL++k+ ++ +++  vi++vd++k+ePwdLp k+k +ekewyfF+++d+ky+tg+r+nrat++gyWkatgkdke+++
  TRIUR3_20284-P1  19 LPPGFRFHPTDEEVVTHYLTPKAVNNAFSC-LVIADVDLNKTEPWDLPGKAKMGEKEWYFFVHKDRKYPTGTRTNRATEKGYWKATGKDKEIFR 111
                      79**************************99.78***************99999****************************************9 PP

              NAM  95 k...kgelvglkktLvfykgrapkgektdWvmheyrle 129
                          +  lvg+kktLvfy+grap+g kt  vmheyrle
  TRIUR3_20284-P1 112 GkgrDAVLVGMKKTLVFYTGRAPRGDKTPYVMHEYRLE 149
                      84444445****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-5815164IPR003441NAC domain
PROSITE profilePS5100552.67119165IPR003441NAC domain
PfamPF023655.6E-2820148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MSDVTAVMDL EVEEPRLSLP PGFRFHPTDE EVVTHYLTPK AVNNAFSCLV IADVDLNKTE  60
PWDLPGKAKM GEKEWYFFVH KDRKYPTGTR TNRATEKGYW KATGKDKEIF RGKGRDAVLV  120
GMKKTLVFYT GRAPRGDKTP YVMHEYRLEG QLPHRLPRSA RDWVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-5081484142NO APICAL MERISTEM PROTEIN
1ut4_B3e-5081484142NO APICAL MERISTEM PROTEIN
1ut7_A3e-5081484142NO APICAL MERISTEM PROTEIN
1ut7_B3e-5081484142NO APICAL MERISTEM PROTEIN
3swm_A3e-5081487145NAC domain-containing protein 19
3swm_B3e-5081487145NAC domain-containing protein 19
3swm_C3e-5081487145NAC domain-containing protein 19
3swm_D3e-5081487145NAC domain-containing protein 19
3swp_A3e-5081487145NAC domain-containing protein 19
3swp_B3e-5081487145NAC domain-containing protein 19
3swp_C3e-5081487145NAC domain-containing protein 19
3swp_D3e-5081487145NAC domain-containing protein 19
4dul_A3e-5081484142NAC domain-containing protein 19
4dul_B3e-5081484142NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
UniProtTranscription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269|PubMed:15295076, ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:21303842, ECO:0000269|PubMed:23340744, ECO:0000269|PubMed:23459204, ECO:0000269|PubMed:9351240}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19608714, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:20404534, ECO:0000269|PubMed:21511905, ECO:0000269|PubMed:22930749}.
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3644980.0AK364498.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2025P03.
GenBankAK3646490.0AK364649.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2027E04.
GenBankAK3670980.0AK367098.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2051F14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020161331.11e-114NAC domain-containing protein 92-like
SwissprotQ9FKA07e-72NAC92_ARATH; NAC domain-containing protein 92
SwissprotQ9FLJ22e-71NC100_ARATH; NAC domain-containing protein 100
TrEMBLT1MQW11e-119T1MQW1_TRIUA; Uncharacterized protein
STRINGTRIUR3_20284-P11e-120(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.13e-74NAC domain containing protein 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Manacorda CA, et al.
    Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes.
    Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98
    [PMID:23945002]
  3. Khan M,Rozhon W,Poppenberger B
    The role of hormones in the aging of plants - a mini-review.
    Gerontology, 2014. 60(1): p. 49-55
    [PMID:24135638]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N
    Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast.
    Plant J., 2015. 81(3): p. 377-87
    [PMID:25440717]
  6. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  7. Kim H, et al.
    Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453
    [PMID:30065116]