PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_18966-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 110aa MW: 12360.9 Da PI: 10.7101 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.3 | 8.6e-09 | 41 | 78 | 10 | 47 |
HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +l++ + k +G+g+W+ I+r + +Rt+ q+ s+ qky TRIUR3_18966-P1 41 QLFLLGLKTYGKGDWRNISRNFVRTRTPTQVASHAQKY 78 789999*******************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 0.0026 | 31 | 81 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-6 | 41 | 77 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.53E-7 | 41 | 79 | No hit | No description |
Pfam | PF00249 | 1.7E-6 | 41 | 78 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.36E-11 | 41 | 83 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.8E-10 | 41 | 81 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MKRNSRVFGS GQSKNEGDTV DMIFGDLRTW ATAGIDEMAM QLFLLGLKTY GKGDWRNISR 60 NFVRTRTPTQ VASHAQKYFI RLSSGTARRS SIHDITTVHL TDDQPPSPSQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KU857036 | 1e-104 | KU857036.1 Triticum aestivum GID2 protein isoform 1 (gid2) mRNA, complete cds. | |||
GenBank | KU857039 | 1e-104 | KU857039.1 Triticum urartu GID2 protein (gid2) mRNA, complete cds. | |||
GenBank | KU857045 | 1e-104 | KU857045.1 Triticum aestivum GID2-A1 protein (gid2-A1) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020200806.1 | 3e-40 | F-box protein GID2-like | ||||
Swissprot | Q8S9H7 | 1e-30 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | M8ATW5 | 2e-76 | M8ATW5_TRIUA; Transcription factor MYB1R1 | ||||
STRING | TRIUR3_18966-P1 | 4e-77 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7886 | 33 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 2e-29 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|