PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_18920-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family TALE
Protein Properties Length: 439aa    MW: 47764.2 Da    PI: 9.4255
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_18920-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.33.5e-103073441954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+  +++ LAk++gLt +qV++WF N R +
  TRIUR3_18920-P1 307 FEHflHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVR 344
                      664459******************************88 PP

2BELL71.71.3e-231872411872
             BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       V+krY+qy++q+q+vi+sFe vag  +a+p+t+lAl+ ++rhFrc+k +i +q+
  TRIUR3_18920-P1 187 TVCKRYRQYYQQVQAVIASFESVAGFSNAAPFTALALRVMARHFRCIKGMILSQL 241
                      69*************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.4E-2067239IPR006563POX domain
PfamPF075267.8E-3572237IPR006563POX domain
PROSITE profilePS5007112.26285348IPR001356Homeobox domain
CDDcd000868.80E-12288349No hitNo description
SMARTSM003893.8E-10288352IPR001356Homeobox domain
SuperFamilySSF466893.08E-17290357IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-28291352IPR009057Homeodomain-like
PfamPF059204.3E-19305344IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MPQGQQLVLN GLTAQQVTAQ QFPQIPTQNF SLSLSSASSN PATTPPAPRK QEPGAAAPAA  60
GPYGPFTGYA TVLGRSRFLG PAQKLLEEIC DVGGAAAHVD HSVPDEGLLD ADAMDGADDA  120
AGHELDTSGP MSGAEQQWKK TRLISMMEER IKDWMLISFA ALSTPFANII CYMKPQLISS  180
VLGRFGTVCK RYRQYYQQVQ AVIASFESVA GFSNAAPFTA LALRVMARHF RCIKGMILSQ  240
LRNTSKMPVK EGMSKDITIF GLGGGGAPVG GFQRGGSVNG FGQPHNIWRP QRGLPERSVT  300
VLRAWLFEHF LHPYPTDGDK QMLAKQTGLT RNQVSNWFIN ARVRLWKPMV EEIHNLEMRQ  360
VHKHSPHDKG QQHGAHGQAH QHSSQQQQQQ RTSCMCAVLA GDWWWAGQQA GSVSAVGGGG  420
AMHVVFPGRE SGRGSERCN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16294352563Homeobox protein Meis2
3k2a_B3e-16294352563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5466470.0AB546647.1 Triticum aestivum WBLH4 mRNA for BEL1-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020175344.10.0BEL1-like homeodomain protein 9
TrEMBLM7ZUN30.0M7ZUN3_TRIUA; BEL1-like homeodomain protein 9
STRINGTRIUR3_18920-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.18e-52TALE family protein