PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_18702-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 277aa    MW: 29741.8 Da    PI: 6.8589
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_18702-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  TRIUR3_18702-P1 16 RGSWTPEEDMRLIAYIQKFGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding56.65.9e-1869114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e l++++++lG++ W++Ia++++ gRt++++k+ w+++l
  TRIUR3_18702-P1  69 RGNFTVEEEETLIKLHNMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.5551163IPR017930Myb domain
SuperFamilySSF466896.97E-3113110IPR009057Homeodomain-like
SMARTSM007178.4E-131565IPR001005SANT/Myb domain
PfamPF002493.6E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-231770IPR009057Homeodomain-like
CDDcd001676.85E-111863No hitNo description
PROSITE profilePS5129424.94564118IPR017930Myb domain
SMARTSM007176.7E-1668116IPR001005SANT/Myb domain
PfamPF002492.9E-1669114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2671118IPR009057Homeodomain-like
CDDcd001671.05E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNRGSWT PEEDMRLIAY IQKFGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTVEEEETL IKLHNMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRVAA  120
SAGEQKKGGA KGKKKTTCAD VPAPSPSPSS STTTTTTTTT NCSSGESGEQ SNTSKELELE  180
LELEKIEIPM LDLGFDLDML LDTVTNTHCP AISSAPTSRC SSASPTCVVD DGALLDLPEI  240
DIVPELWSIM DGEGGAGACG GTGPFTFAVV SLSEQAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2486490.0AK248649.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf178a22, mRNA sequence.
GenBankAK3696890.0AK369689.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2095N02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020185012.11e-149myb-related protein Zm1-like
SwissprotP200242e-92MYB1_MAIZE; Myb-related protein Zm1
TrEMBLM7ZGT60.0M7ZGT6_TRIUA; Myb-related protein Zm1
STRINGTRIUR3_18702-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.14e-71myb domain protein 63
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]