PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_17688-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 255aa    MW: 28540.4 Da    PI: 8.4227
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_17688-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM124.96.8e-3929435128
              NAM  35 kevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +vd++k+ePwdLp+ +  + kewyf+s rd+kyatg+r+nrat+sgyWkatgkd+++ + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r 
  TRIUR3_17688-P1   2 VDVDLNKIEPWDLPEIACIGGKEWYFYSLRDRKYATGQRTNRATESGYWKATGKDRAISR-KGLLVGMRKTLVFYEGRAPKGKKTEWVMHEFRK 94 
                      689***********7666789*************************************99.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100545.1631117IPR003441NAC domain
SuperFamilySSF1019412.35E-462117IPR003441NAC domain
PfamPF023656.8E-151593IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MVDVDLNKIE PWDLPEIACI GGKEWYFYSL RDRKYATGQR TNRATESGYW KATGKDRAIS  60
RKGLLVGMRK TLVFYEGRAP KGKKTEWVMH EFRKEGQGDL MKLPLKEDWV LCRVFYKTRT  120
TIAKPSTGSN YNIDSAAATS LPPLIDNYIA FDHPGMSTVQ NLEGYEQVPC FSNGPSSHPS  180
SSASMNIPVM AMAPMAADQE QQHMGKAIKD ALSQLTRFEQ GNVKREAPAQ GGVFAQDGFE  240
YLAESGFSQM WNSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-38111749165NO APICAL MERISTEM PROTEIN
1ut4_B8e-38111749165NO APICAL MERISTEM PROTEIN
1ut7_A8e-38111749165NO APICAL MERISTEM PROTEIN
1ut7_B8e-38111749165NO APICAL MERISTEM PROTEIN
3swm_A9e-38111752168NAC domain-containing protein 19
3swm_B9e-38111752168NAC domain-containing protein 19
3swm_C9e-38111752168NAC domain-containing protein 19
3swm_D9e-38111752168NAC domain-containing protein 19
3swp_A9e-38111752168NAC domain-containing protein 19
3swp_B9e-38111752168NAC domain-containing protein 19
3swp_C9e-38111752168NAC domain-containing protein 19
3swp_D9e-38111752168NAC domain-containing protein 19
4dul_A8e-38111749165NAC domain-containing protein 19
4dul_B8e-38111749165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0275720.0HM027572.1 Triticum aestivum NAC transcription factor 7 (NAC7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020174529.11e-176NAC domain-containing protein 21/22-like
SwissprotQ84TE65e-72NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM7ZYU00.0M7ZYU0_TRIUA; NAC domain-containing protein 21/22
STRINGTRIUR3_17688-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.28e-73NAC domain containing protein 1
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]