PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_16398-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family TALE
Protein Properties Length: 529aa    MW: 57022.8 Da    PI: 6.2814
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_16398-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.74e-082963331954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +e+  LA++ gL+  qV++WF N R +
  TRIUR3_16398-P1 296 FEHflHPYPKDSEKVMLARQAGLSRGQVSNWFINARVR 333
                      554459******************************88 PP

2BELL115.33.2e-37158229172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erq+lq+k + L+ +l++Vd+rY++y++q+q+v+ssF+avag g+akpYt+lAl++iSrhFr+L+dai  q+
  TRIUR3_16398-P1 158 ERQDLQNKVTALMAMLDQVDRRYRHYHQQMQMVVSSFDAVAGSGAAKPYTALALQTISRHFRSLRDAIGAQV 229
                      799*****************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.3E-5190227IPR006563POX domain
PfamPF075261.2E-4896225IPR006563POX domain
PROSITE profilePS5007111.839274337IPR001356Homeobox domain
SMARTSM003896.2E-8277341IPR001356Homeobox domain
CDDcd000862.55E-11277338No hitNo description
SuperFamilySSF466892.57E-16278344IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-26280343IPR009057Homeodomain-like
PfamPF059202.2E-16294333IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MATFFSTSND QRGLAGGGGG GGDMSFHHHY PMSNQYPDSS TGGLIPLPAS IVQQSHIAHH  60
GGGGDGRDDE TAAFMSPNQS AMAMAASRNA QVNVYVQNSR FLKAARELLD EVVSVRDAIK  120
RKGDRKDDSA GNGECGKVEG DKGEENEGSP AAELSPAERQ DLQNKVTALM AMLDQVDRRY  180
RHYHQQMQMV VSSFDAVAGS GAAKPYTALA LQTISRHFRS LRDAIGAQVQ SARRSLGEPQ  240
DGSGAGGLSR LRYIDQHLRQ QRAMQQFGMM QQPQHAWRPQ RGLPESAVSV LRAWLFEHFL  300
HPYPKDSEKV MLARQAGLSR GQVSNWFINA RVRLWKPMVE EMYKEEFGAE MDSTNSSSEN  360
AGNKHGKVDE AACSEDQDRD EFQSTSTHAG ASQLLNAYKS EPVGSMDAGP LSSLGGGDMG  420
TTYAPAGLSL NHHGPGGGSL LQDAFAHHGG DDARFVTYGG SMGDLGGSVS LTLGLQHCNN  480
NNNNNAGHVP PEQQGLLYGN PGDFDFLNGG DDRQRFASSS SQLLHDFVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16283340158Homeobox protein Meis1
4xrs_B2e-16283340158Homeobox protein Meis1
5bng_A1e-16283341159Homeobox protein Meis2
5bng_B1e-16283341159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3675790.0AK367579.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2059B17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020165933.10.0BEL1-like homeodomain protein 7
TrEMBLM7ZIZ10.0M7ZIZ1_TRIUA; BEL1-like homeodomain protein 6
STRINGTRIUR3_16398-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-116BEL1-like homeodomain 7