PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_13997-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 233aa MW: 27467.7 Da PI: 10.4212 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50 | 6.9e-16 | 35 | 84 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48 r+rW +eEd +l +v+q+G++ W+++a++m+ + R +k+c +rw +yl TRIUR3_13997-P1 35 RQRWRPEEDAILRSYVRQYGPREWNLVAQRMNvpLDRDAKSCLERWKNYL 84 89**********************************************97 PP | |||||||
2 | Myb_DNA-binding | 34.9 | 3.6e-11 | 90 | 134 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+ T +E+ l +++ +++G++ Wk+Ia++++ gRt+k + +w + TRIUR3_13997-P1 90 KGSLTDDEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 134 57789*****************.*********.*****999999766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.3 | 30 | 84 | IPR017930 | Myb domain |
SMART | SM00717 | 8.7E-13 | 34 | 86 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.92E-21 | 35 | 129 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.78E-9 | 37 | 84 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-21 | 37 | 91 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 4.5E-14 | 38 | 98 | No hit | No description |
PROSITE profile | PS51294 | 22.391 | 85 | 139 | IPR017930 | Myb domain |
SMART | SM00717 | 1.4E-9 | 89 | 137 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-15 | 92 | 133 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.18E-6 | 94 | 135 | No hit | No description |
SuperFamily | SSF144020 | 2.22E-5 | 97 | 226 | IPR024064 | FdhE-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008356 | Biological Process | asymmetric cell division | ||||
GO:0009615 | Biological Process | response to virus | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0010338 | Biological Process | leaf formation | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0045088 | Biological Process | regulation of innate immune response | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0000793 | Cellular Component | condensed chromosome | ||||
GO:0005730 | Cellular Component | nucleolus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MEYQQASERI THVPGISLPS LLHGHCEVRM EMKERQRWRP EEDAILRSYV RQYGPREWNL 60 VAQRMNVPLD RDAKSCLERW KNYLRPGIKK GSLTDDEQRL VIRLQAKHGN KWKKIAAEVP 120 GRTAKRLGKW WEVFKEKQQR EIRDSRRPPP EPSPDERGRY EWLLENFAEK LVKERQQRVV 180 ATYRAAGRCP YCGGGVVATD VESAPRLCYV PLCFRVRRRF HCSLCSRRLA SIA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-15 | 38 | 131 | 7 | 97 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 2e-15 | 38 | 132 | 7 | 98 | C-Myb DNA-Binding Domain |
1msf_C | 2e-15 | 38 | 132 | 7 | 98 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for normal cell differentiation. Interacts directly with asymmetric leaves 2 (AS2) to repress the knox homeobox genes. {ECO:0000269|PubMed:10102816, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:9655808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB443456 | 0.0 | AB443456.1 Triticum aestivum WRS2 mRNA for Myb transcription factor, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020182147.1 | 1e-101 | protein rough sheath 2 | ||||
Swissprot | Q9S7B2 | 5e-82 | RS2_MAIZE; Protein rough sheath 2 | ||||
TrEMBL | M7Y976 | 1e-170 | M7Y976_TRIUA; Protein rough sheath 2 | ||||
STRING | TRIUR3_13997-P1 | 1e-171 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5190 | 36 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37630.1 | 4e-69 | MYB family protein |