PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_11787-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 469aa    MW: 52253.2 Da    PI: 9.264
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_11787-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1553.4e-481863086129
              NAM   6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                       FhPtdee+++ yL +kv + ++++  +i+evd++k +P +Lp+k+k +ekewyf++++d+ky+tg ++nratk+gyWkatgkdke+++   +l
  TRIUR3_11787-P1 186 WFHPTDEEIITSYLVPKVLKPTFTT-IAIAEVDLNKNDPYELPEKAKMGEKEWYFYCQKDRKYPTGIQTNRATKAGYWKATGKDKEIFHPLPTL 278
                      5*********************999.88***************99999******************************************999* PP

              NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                      +g+kktLvfykgrap+gekt+Wvmheyrle
  TRIUR3_11787-P1 279 IGMKKTLVFYKGRAPRGEKTNWVMHEYRLE 308
                      ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-52178343IPR003441NAC domain
PROSITE profilePS5100549.502181343IPR003441NAC domain
PfamPF023655.9E-24186307IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MRGFIVRMWP GDSLPNTYFG LVRRLVDACP RLEVIKRSVC IEGVRRAFAR AKVHWAKMDA  60
EKLVQDAATV HKDSSEAFCC AYKPALEALL LGGILRHDKF FVAEAHLVFG EGHVRYGNLN  120
YTADIHGDSI FNGFEPLPSA PHGHDEHDLA LPSDAGFLGS HPGLLQVRRL RPVFFFKKAG  180
VGYSIWFHPT DEEIITSYLV PKVLKPTFTT IAIAEVDLNK NDPYELPEKA KMGEKEWYFY  240
CQKDRKYPTG IQTNRATKAG YWKATGKDKE IFHPLPTLIG MKKTLVFYKG RAPRGEKTNW  300
VMHEYRLEIS KQPAYGPSTA IAKAAAINAS SKKERVVCKI FHKNIGVKKV VTPSYAMHMP  360
MFIGGEQQQG SLNSYSSYQL HAARVGLAMT GSLVLPMVNN PHHEMMGGNP MVSYQQQQMM  420
QMQMQMGADQ CFMVGVEPGS ESSSMVSGEG VDRLGNNVQG NGATTTIDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-4018734923171NO APICAL MERISTEM PROTEIN
1ut4_B6e-4018734923171NO APICAL MERISTEM PROTEIN
1ut7_A6e-4018734923171NO APICAL MERISTEM PROTEIN
1ut7_B6e-4018734923171NO APICAL MERISTEM PROTEIN
3swm_A9e-4018734926174NAC domain-containing protein 19
3swm_B9e-4018734926174NAC domain-containing protein 19
3swm_C9e-4018734926174NAC domain-containing protein 19
3swm_D9e-4018734926174NAC domain-containing protein 19
3swp_A9e-4018734926174NAC domain-containing protein 19
3swp_B9e-4018734926174NAC domain-containing protein 19
3swp_C9e-4018734926174NAC domain-containing protein 19
3swp_D9e-4018734926174NAC domain-containing protein 19
4dul_A6e-4018734923171NAC domain-containing protein 19
4dul_B6e-4018734923171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703064e-68HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020179085.11e-170NAC domain-containing protein 92-like
TrEMBLT1M2V90.0T1M2V9_TRIUA; Uncharacterized protein
STRINGTRIUR3_11787-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.28e-64Arabidopsis NAC domain containing protein 87