PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_10933-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 121aa MW: 13769.7 Da PI: 8.6452 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 40.8 | 5.2e-13 | 2 | 42 | 8 | 48 |
HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 Ed++lv +++ +G g W + +++ g++R++k+c++rw++yl TRIUR3_10933-P1 2 EDDILVSYINDHGEGKWGSLPKRAGLNRCGKSCRLRWLNYL 42 9***************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.568 | 1 | 46 | IPR017930 | Myb domain |
SMART | SM00717 | 3.6E-4 | 1 | 44 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.24E-8 | 2 | 42 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.8E-16 | 2 | 45 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.0E-11 | 2 | 42 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.84E-17 | 2 | 69 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.9E-6 | 46 | 69 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MEDDILVSYI NDHGEGKWGS LPKRAGLNRC GKSCRLRWLN YLRPGIKRGN ISDDEEELIV 60 RLHGLLGNRS RTKCHSLPDL AQQPLLIDLH HDLEKALTYN NHALCQTVTY AEAAANLVRR 120 K |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB599721 | 7e-82 | AB599721.1 Triticum aestivum Tamyb10-A1 gene for myb-related protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020156360.1 | 3e-42 | transcription repressor MYB6-like | ||||
Swissprot | Q9FJA2 | 4e-32 | TT2_ARATH; Transcription factor TT2 | ||||
TrEMBL | M7ZT91 | 9e-84 | M7ZT91_TRIUA; Transcription factor TT2 | ||||
STRING | TRIUR3_10933-P1 | 2e-84 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35550.1 | 2e-34 | MYB family protein |