PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_10777-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 152aa MW: 16657 Da PI: 10.2652 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 52 | 1.3e-16 | 22 | 62 | 48 | 88 |
EEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS B3 48 vkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 ++++y+++s++yvltkGW++Fvk++gL +gD vvF+++ + TRIUR3_10777-P1 22 FRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVVFYRSASG 62 8999********************************66433 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 9.545 | 1 | 74 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 4.32E-15 | 20 | 71 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 2.4E-18 | 21 | 77 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 1.84E-12 | 22 | 59 | No hit | No description |
Pfam | PF02362 | 1.5E-13 | 22 | 64 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MVASKVTDVG PSGCNLLFTT GFRYSYWNSS QSYVLTKGWS RFVKEKGLHA GDAVVFYRSA 60 SGNNQFFIDC KLRSMTTTTT FVNATAATTL PAPVMRTVRL FGVDLLTAPA LRHAPEHEDY 120 GMAKTNKRFV DASVAAATPA HAVWKKREQG IA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wid_A | 9e-19 | 22 | 74 | 66 | 118 | DNA-binding protein RAV1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK371941 | 1e-114 | AK371941.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2143K20. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020159691.1 | 7e-65 | AP2/ERF and B3 domain-containing protein Os05g0549800-like | ||||
Swissprot | Q6L4H4 | 9e-33 | Y5498_ORYSJ; AP2/ERF and B3 domain-containing protein Os05g0549800 | ||||
TrEMBL | T1M045 | 1e-109 | T1M045_TRIUA; Uncharacterized protein | ||||
STRING | TRIUR3_10777-P1 | 1e-110 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP29063 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68840.2 | 2e-23 | related to ABI3/VP1 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|