PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_10339-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 128aa MW: 13511.5 Da PI: 8.2824 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 127.6 | 5.7e-40 | 27 | 114 | 1 | 88 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqle 88 +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++lp+++reda+ssl+yeAear +dPvyG+ + ++ lq+q + TRIUR3_10339-P1 27 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELPPHQREDAVSSLAYEAEARGKDPVYGCGRALSVLQRQCM 114 7***********************************************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.811 | 26 | 127 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.5E-39 | 27 | 114 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MASPSSTGNS AVSVVVAAPT TPGAGAPCAA CKFLRRKCLP GCVFAPYFPP EEPQKFANVH 60 KVFGASNVTK LLNELPPHQR EDAVSSLAYE AEARGKDPVY GCGRALSVLQ RQCMWITSPT 120 LKTDGCGE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-62 | 17 | 112 | 1 | 96 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-62 | 17 | 112 | 1 | 96 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF091493 | 1e-167 | EF091493.1 Triticum aestivum ramosa 2 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020171773.1 | 9e-72 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_020171774.1 | 9e-72 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 6e-51 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | M7ZKK6 | 2e-89 | M7ZKK6_TRIUA; Uncharacterized protein | ||||
STRING | TRIUR3_10339-P1 | 3e-90 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8813 | 35 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 5e-49 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|