PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_09915-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 430aa    MW: 47111.7 Da    PI: 6.7476
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_09915-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.4e-541332581128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL+kkv++ ++ +  +++ +d++k+ePwdLp+ ++ +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkdk++++
  TRIUR3_09915-P1 133 LPPGFRFHPTDEELITHYLAKKVADARFAA-LAVSVADLNKCEPWDLPSLARMGEKEWYFFCLKDRKYPTGLRTNRATESGYWKATGKDKDIFR 225
                      79*************************999.569999***********8778899*************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++lvg+kktLvfy+grapkg k+ Wvmheyrl
  TRIUR3_09915-P1 226 -GKALVGMKKTLVFYTGRAPKGDKSGWVMHEYRL 258
                      .99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-61128268IPR003441NAC domain
PROSITE profilePS5100555.858133314IPR003441NAC domain
PfamPF023651.3E-29134258IPR003441NAC domain
SuperFamilySSF1019414.18E-61302314IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MGSGQPLGSL MPEYPDTQES DTINVDAPEK DVEHIPVLDR KKKRAGFMEE ELSVFSSMTE  60
AVKEVASAIR ESKSVDVHPK LYSAVMDQIV FSPEDLMVAL SHLLDNVGCI DLSVCREKQV  120
MEHGEQEQHA MDLPPGFRFH PTDEELITHY LAKKVADARF AALAVSVADL NKCEPWDLPS  180
LARMGEKEWY FFCLKDRKYP TGLRTNRATE SGYWKATGKD KDIFRGKALV GMKKTLVFYT  240
GRAPKGDKSG WVMHEYRLNA KLHAASTSRG SLSGGRAASS RVATSFHHAT CILLLLVIDH  300
IYLNEWVLCR VFKKSLLGGV VSSAPASSAA KKSGVGTMEE IGSSVAAVTP LPPPLGILGL  360
VRLLESSGYH RGLADDMAPC GNQQQQPAAC KGERERLSAS QDTGLTSDVN PEISSSFGQK  420
FDHEPAPWGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-4913131415165NO APICAL MERISTEM PROTEIN
1ut4_B9e-4913131415165NO APICAL MERISTEM PROTEIN
1ut7_A9e-4913131415165NO APICAL MERISTEM PROTEIN
1ut7_B9e-4913131415165NO APICAL MERISTEM PROTEIN
3swm_A1e-4813131418168NAC domain-containing protein 19
3swm_B1e-4813131418168NAC domain-containing protein 19
3swm_C1e-4813131418168NAC domain-containing protein 19
3swm_D1e-4813131418168NAC domain-containing protein 19
3swp_A1e-4813131418168NAC domain-containing protein 19
3swp_B1e-4813131418168NAC domain-containing protein 19
3swp_C1e-4813131418168NAC domain-containing protein 19
3swp_D1e-4813131418168NAC domain-containing protein 19
4dul_A9e-4913131415165NAC domain-containing protein 19
4dul_B9e-4913131415165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0931111e-167FP093111.1 Phyllostachys edulis cDNA clone: bphyem126o09, full insert sequence.
GenBankFP0977531e-167FP097753.1 Phyllostachys edulis cDNA clone: bphyem208n21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020168413.11e-133NAC domain-containing protein 92-like
TrEMBLT1LXU50.0T1LXU5_TRIUA; Uncharacterized protein
STRINGTRIUR3_09915-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27303787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.12e-79NAC domain containing protein 100