PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_09042-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 108aa MW: 11779.5 Da PI: 4.7585 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 49.1 | 1.4e-15 | 65 | 108 | 50 | 93 |
NF-YB 50 asdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 as+k+ +ek k ngddl+w+++tl fedyveplk++lk yrel TRIUR3_09042-P1 65 ASNKSVKEKCKIANGDDLIWSMGTLAFEDYVEPLKMHLKLYREL 108 89****************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 5.44E-6 | 64 | 107 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.5E-8 | 65 | 107 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MGRDRQLLLI TARRGMEIRG RLSPRAVPAG VGCVLLPPVE DDEGEDEDAE AGEGGGGGGV 60 RPLWASNKSV KEKCKIANGD DLIWSMGTLA FEDYVEPLKM HLKLYREL |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM078742 | 2e-32 | KM078742.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D11) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | M8A5F1 | 2e-71 | M8A5F1_TRIUA; Nuclear transcription factor Y subunit B-4 | ||||
STRING | TRIUR3_09042-P1 | 3e-72 | (Triticum urartu) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.3 | 1e-15 | nuclear factor Y, subunit B1 |