PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_08851-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 341aa    MW: 39569.2 Da    PI: 6.7424
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_08851-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.76.5e-5591391129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                      +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++      ++e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk
  TRIUR3_08851-P1   9 VPPGFRFHPTDEELVDYYLRKKVASRRIDL-NVIKDVDLYKIEPWDLQEkcriGPEEEQSDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDK 101
                      69****************************.99**************95343322335669********************************* PP

              NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ++++ k+ lvg++ktLv+ykgrap+g+k+dW+mheyrle
  TRIUR3_08851-P1 102 PIYA-KHCLVGMRKTLVYYKGRAPNGQKSDWIMHEYRLE 139
                      ****.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-606164IPR003441NAC domain
PROSITE profilePS5100558.6489164IPR003441NAC domain
PfamPF023651.4E-2810138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MSGSTQPQVP PGFRFHPTDE ELVDYYLRKK VASRRIDLNV IKDVDLYKIE PWDLQEKCRI  60
GPEEEQSDWY FFSHKDKKYP TGTRTNRATA AGFWKATGRD KPIYAKHCLV GMRKTLVYYK  120
GRAPNGQKSD WIMHEYRLET NENGPPQASY GYEEGWVVCR VFKKRLPTTR RDLDHDAPCW  180
YVDDDGPFMH DLNSPMRGMP PHHSMALQEQ HLQMLNNTYK RELKLQYQMP NHHHVLNTIP  240
HELESPSSFH SLLVSPDDHQ INVHHAQHHH VQLIDHAVDD QAATDWRVLD KFVASQLSND  300
AAKSVDYAHE GDILQLNEKA QELATDYAST STSSSQVDPW K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-49816514169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020160525.10.0NAC domain-containing protein 7-like
SwissprotQ9FWX21e-113NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM8ALU30.0M8ALU3_TRIUA; NAC domain-containing protein 7
STRINGTRIUR3_08851-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP121023039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.12e-99NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]