PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_05688-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 102aa MW: 11343.5 Da PI: 4.6764 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 40.1 | 8.5e-13 | 6 | 65 | 37 | 96 |
NF-YB 37 ecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 e + fi ++++ a+d c+ kr+tin++d++ al ++ f ++vepl++ l+++r +++ TRIUR3_05688-P1 6 ESARIFIHYLSATANDVCKDGKRQTINAEDVFKALDEIEFPEFVEPLRTALEEFRSRNAA 65 66778**************************************************87765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.29E-20 | 3 | 97 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 2.2E-25 | 3 | 95 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-6 | 4 | 40 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MAAFAESARI FIHYLSATAN DVCKDGKRQT INAEDVFKAL DEIEFPEFVE PLRTALEEFR 60 SRNAARKPAS GKKQSENKRK LDKEAVPEEQ NGAADEANAG ED |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK371068 | 1e-122 | AK371068.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2124A02. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188630.1 | 6e-60 | neurofilament heavy polypeptide-like isoform X1 | ||||
Refseq | XP_020188631.1 | 4e-60 | DNA polymerase epsilon subunit 3-like isoform X2 | ||||
TrEMBL | A0A3B6HXJ7 | 3e-66 | A0A3B6HXJ7_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446RB99 | 3e-66 | A0A446RB99_TRITD; Uncharacterized protein | ||||
TrEMBL | M7Z898 | 5e-67 | M7Z898_TRIUA; DNA polymerase epsilon subunit 3 | ||||
STRING | Traes_4AL_6566FA47B.1 | 5e-67 | (Triticum aestivum) | ||||
STRING | TRIUR3_05688-P1 | 8e-68 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10414 | 37 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G27470.1 | 3e-27 | nuclear factor Y, subunit B11 |