PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_01582-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 349aa    MW: 39228.9 Da    PI: 7.8288
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_01582-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.3e-52161441129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lp+GfrFhPtd e++++yL +kv +k++++ +vikevd++k+ePwdL+++v+ +ek+ yfFsk+d ky+tg r+nrat++gyWkatgkdke+++
  TRIUR3_01582-P1  16 LPAGFRFHPTDMEIITFYLVRKVLKKPFDV-TVIKEVDLNKCEPWDLRNNVNMGEKDQYFFSKKDLKYPTGVRTNRATNAGYWKATGKDKEIVH 108
                      799***************************.99***************99999***************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                        + +l+g+kktLvfykgrap+gekt+W+mheyrle
  TRIUR3_01582-P1 109 PpTMSLIGMKKTLVFYKGRAPRGEKTNWIMHEYRLE 144
                      978889****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-5710179IPR003441NAC domain
PROSITE profilePS5100554.54316179IPR003441NAC domain
PfamPF023652.9E-2617143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MAVHLQVQQQ QQHLNLPAGF RFHPTDMEII TFYLVRKVLK KPFDVTVIKE VDLNKCEPWD  60
LRNNVNMGEK DQYFFSKKDL KYPTGVRTNR ATNAGYWKAT GKDKEIVHPP TMSLIGMKKT  120
LVFYKGRAPR GEKTNWIMHE YRLEMGKQHT PDLPTDIVRA ASINASSKEE YVICRIFHKS  180
TGLRKVVMPS YSMPIPMSMG VEQQQGFLES NTLAPLMDYD VPSSLAPLSS LPAASLYQMH  240
NFGAESSMMG SAVLPMMNNQ YFENHHHQMM VAPPQSSMSV YNNQQQQMMH MSAEQGFMVG  300
VDPGSGTSSI VSHEDVLTGT SNNIQGNGGA TISSEISSVN MGMDGMWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-4741853171NO APICAL MERISTEM PROTEIN
1ut4_B4e-4741853171NO APICAL MERISTEM PROTEIN
1ut7_A4e-4741853171NO APICAL MERISTEM PROTEIN
1ut7_B4e-4741853171NO APICAL MERISTEM PROTEIN
4dul_A4e-4741853171NAC domain-containing protein 19
4dul_B4e-4741853171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0275750.0HM027575.2 Triticum aestivum NAC transcription factor NAM (NAM) mRNA, complete cds.
GenBankKT7611890.0KT761189.1 Triticum aestivum NAM like-protein transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020148654.10.0NAC domain-containing protein 100-like
RefseqXP_020166014.10.0NAC domain-containing protein 100-like
TrEMBLT1LAQ30.0T1LAQ3_TRIUA; Uncharacterized protein
STRINGTRIUR3_01582-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-69NAC domain containing protein 58