PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_01346-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 650aa    MW: 70561.1 Da    PI: 4.1099
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_01346-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM60.94e-1955577128
              NAM  77 atksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++gyWkatgkd+++++  g++vg kktLv+++grap+ge+tdWvmhey++
  TRIUR3_01346-P1   5 TAADGYWKATGKDRSICN-AGRAVGNKKTLVYHHGRAPRGERTDWVMHEYTI 55 
                      5679**************.999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100526.492178IPR003441NAC domain
SuperFamilySSF1019413.53E-21578IPR003441NAC domain
PfamPF023656.9E-8655IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
RSSPTAADGY WKATGKDRSI CNAGRAVGNK KTLVYHHGRA PRGERTDWVM HEYTILADAL  60
PPPARGRESY ALYKLFEKSG VGPKNGEQYG APFREEDWLD DDDDCELPAD PIPIAVSLPT  120
RTVTVVEQIG DVLTVDDQIG DVLTVVDQIG GVAVDKQIGV MTVDDQIGDL EVFLLQNGDD  180
QGNSEPQSDF STPVSSQAPL QHGHPQGRPS DDGNTSEVAD ATTSSRGMVM AENTCTELPF  240
GDLEGLLMEI SDDQRATESF QEFSEFVPQL QLQHDDHEHE AWPNANMEEI SVADYTTSNG  300
VVDASGCTVT ELPYEDIEGL LLQLENDQGN VQPLADFSTP VPRHEFHQVG SGDFHGCHGA  360
TFSSVDPSSA VQENRDLDPR SDPSNQITQS ALTNMPLNWE TDCTEETSAM RSVSGLASYD  420
GQDADEEFLE INDFLDPEDV GQQSMNCTAT EHLISSSNGM FDSLEFADAS MFLPGSFDTA  480
GVATENQFGY LGDSGSQNQG LQYTSESWTH NQVALNVRNH MNHNHVVFSH ASGTANFHTV  540
NEQPHNLSPA DSQSWFNSAV SALLDAVPAN PALAAENNVL NRTLQRISSF RSEQAPKEEA  600
SAPVIQVRRR GAGLISVSLL VLLAAILWTF AAGTGYAIKF CKGLWKSSST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-1415586140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3555520.0AK355552.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1022I04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020192727.10.0uncharacterized protein LOC109778571
TrEMBLT1LA390.0T1LA39_TRIUA; Uncharacterized protein
STRINGTRIUR3_01346-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP91282840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.15e-37NAC domain containing protein 17