PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_00447-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 347aa    MW: 39284 Da    PI: 8.5566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_00447-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.36.1e-53141411129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdee++++y  +kv ++ + +  +i++v+++k+ePw+Lp+k+k +ekewyf+s++d+ky+tg r+nrat++gyWkatgkdke+++
  TRIUR3_00447-P1  14 LPPGFRFHPTDEEIIKFYVVPKVLDEAFVA-AAIEDVNLNKYEPWELPEKAKMGEKEWYFYSRKDRKYPTGIRTNRATEAGYWKATGKDKEIFQ 106
                      79*************************998.78***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +l+g+kktLvfykgrap+gekt+W+mheyrle
  TRIUR3_00447-P1 107 PPFKLIGMKKTLVFYKGRAPRGEKTNWIMHEYRLE 141
                      *********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-595176IPR003441NAC domain
PROSITE profilePS5100557.4614176IPR003441NAC domain
PfamPF023651.8E-2615140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MADHLQVQQK QLVLPPGFRF HPTDEEIIKF YVVPKVLDEA FVAAAIEDVN LNKYEPWELP  60
EKAKMGEKEW YFYSRKDRKY PTGIRTNRAT EAGYWKATGK DKEIFQPPFK LIGMKKTLVF  120
YKGRAPRGEK TNWIMHEYRL ESSKKLTSNP SITTRTVTRT NMASKEQWVV CRIFHKSTGL  180
KKMVTPSYDM PMYTGAEHQQ GFVDLDTLPP LMEYDMSSTC AHAPLFPGAS SYKSHDVGTG  240
SSMMGSVALP MMNYHYIGNN HHHQMMVNPT LPLSLYQHQQ QHQQMMMHMG ADQGLMVGAQ  300
PGGGLASMLS QEDAVAGLRN NYPGNTAATA VGETSLMNMG MDDIWQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-5121821171NO APICAL MERISTEM PROTEIN
1ut4_B8e-5121821171NO APICAL MERISTEM PROTEIN
1ut7_A8e-5121821171NO APICAL MERISTEM PROTEIN
1ut7_B8e-5121821171NO APICAL MERISTEM PROTEIN
4dul_A8e-5121821171NAC domain-containing protein 19
4dul_B8e-5121821171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0959592e-35FP095959.1 Phyllostachys edulis cDNA clone: bphylf054m05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020197195.10.0NAC domain-containing protein 92-like isoform X1
SwissprotQ9FK442e-74NAC87_ARATH; NAC domain-containing protein 87
TrEMBLT1L7P70.0T1L7P7_TRIUA; Uncharacterized protein
STRINGTRIUR3_00447-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.14e-77NAC domain containing protein 58
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]