PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_00446-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 341aa    MW: 38097.8 Da    PI: 9.2892
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_00446-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1721.8e-53141411129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdee++++y ++kv ++ + +  +i++v+++k+ePw+Lp+k+k + kewyf++++d+ky+tg r+nrat++gyWkatgkdke+++
  TRIUR3_00446-P1  14 LPPGFRFHPTDEEIIKFYVAPKVLDEAFVA-AAIEDVNLNKYEPWELPEKAKMGGKEWYFYCRKDRKYPTGIRTNRATNAGYWKATGKDKEIFH 106
                      79*************************998.78***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +l+g+kktLvfykgrap+gekt+W+mheyrle
  TRIUR3_00446-P1 107 PPLTLIGMKKTLVFYKGRAPRGEKTNWIMHEYRLE 141
                      *********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-585150IPR003441NAC domain
PROSITE profilePS5100555.2114200IPR003441NAC domain
PfamPF023653.0E-2715140IPR003441NAC domain
SuperFamilySSF1019411.31E-58188200IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MTDHLQVQQQ KLELPPGFRF HPTDEEIIKF YVAPKVLDEA FVAAAIEDVN LNKYEPWELP  60
EKAKMGGKEW YFYCRKDRKY PTGIRTNRAT NAGYWKATGK DKEIFHPPLT LIGMKKTLVF  120
YKGRAPRGEK TNWIMHEYRL ESNKQLTSNP STATRTVTIT NAASKDGKVD RGQMLELRPR  180
GVTVSPFPEE QWVVCRIFHK SAGLKKMVMP SYVMPMSIGA EHQQGFADLD TLPPLMGYEM  240
SSSLANPMLL PTTSPYQLRD IGAGSSIMGI SWSGLHQQMM MYAGAGRGFM VGAEPGCAPS  300
SMVSQEHAVT GLSNNYQGNA AATAVGKTSS MNMGMDDMWK Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-46914010140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190152.10.0NAC domain-containing protein 79-like
RefseqXP_020197199.10.0NAC domain-containing protein 79-like
SwissprotQ9FLJ21e-72NC100_ARATH; NAC domain-containing protein 100
TrEMBLT1L7P60.0T1L7P6_TRIUA; Uncharacterized protein
STRINGTRIUR3_00446-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.27e-76NAC domain containing protein 38
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]