PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA4121 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 144aa MW: 16419.6 Da PI: 6.7339 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 120.3 | 1.1e-37 | 10 | 110 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 +CaaCk +rr+C++dC+++pyfp ++p++f vh+++G snv k+l++lp++ r++a+++l+ eA++r++dPvyG+vg+i+kl + Tp57577_TGAC_v2_mRNA4121 10 RCAACKNQRRRCPSDCIFSPYFPPNDPQRFVSVHRIYGGSNVGKMLQQLPNNVRQQAANTLYLEAKCRIQDPVYGCVGIISKLYE 94 6************************************************************************************ PP DUF260 86 qleqlkaelallkeel 101 q++ ++ ela++++++ Tp57577_TGAC_v2_mRNA4121 95 QIHDTEIELAKIQTQI 110 ***********99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.801 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.4E-38 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
FDFDIMINGR CAACKNQRRR CPSDCIFSPY FPPNDPQRFV SVHRIYGGSN VGKMLQQLPN 60 NVRQQAANTL YLEAKCRIQD PVYGCVGIIS KLYEQIHDTE IELAKIQTQI ACHKPQNPQF 120 EAESNFNDLS TVDAELNLNF LPPQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-33 | 11 | 110 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-33 | 11 | 110 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA4121 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CU179894 | 6e-64 | CU179894.1 Medicago truncatula chromosome 5 clone mth4-21m22, COMPLETE SEQUENCE. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004491406.1 | 1e-84 | LOB domain-containing protein 23-like | ||||
Swissprot | P59467 | 6e-47 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
Swissprot | P59468 | 6e-47 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A1S2XPB0 | 3e-83 | A0A1S2XPB0_CICAR; LOB domain-containing protein 23-like | ||||
STRING | XP_004491406.1 | 4e-84 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 3e-49 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA4121 |