PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA40629
Organism
Trifolium pratense
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB_related
Protein Properties Length: 74aa    MW: 8784.22 Da    PI: 10.5881
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA40629genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-162168148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g W++eEde+l ++  + G g+W+ +ar  g+ R++k+c++rw +yl
  Tp57577_TGAC_v2_mRNA40629 21 KGLWSPEEDEKLMNYMVRNGQGCWSDVARNAGLERCGKSCRLRWINYL 68
                               678*******************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-231374IPR009057Homeodomain-like
SuperFamilySSF466894.19E-171674IPR009057Homeodomain-like
PROSITE profilePS5129423.8171672IPR017930Myb domain
SMARTSM007172.2E-112070IPR001005SANT/Myb domain
PfamPF002493.9E-152168IPR001005SANT/Myb domain
CDDcd001671.48E-82468No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MRKPEVCSTK NNNINKKKLR KGLWSPEEDE KLMNYMVRNG QGCWSDVARN AGLERCGKSC  60
RLRWINYLRP DLKR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in the regulation of secondary wall biosynthesis in fibers and vessels (PubMed:17890373). Transcription activator of the mannan synthase CSLA9 that recognizes and binds to the DNA consensus sequence 5'-[AG][GT]T[AT]GGT[GA]-3' cis-regulatory element of CSLA9 promoter (PubMed:24243147). Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1. Functions redundantly with MYB83 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). Is an obligate component of the transcriptional regulatory complex toward the commitment of secondary wall cellulose synthesis. Is required for functional expression of the three secondary wall CESA genes, CESA4, CESA7 and CESA8 (PubMed:23726771). {ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:23726771, ECO:0000269|PubMed:24243147}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA40629
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by salicylic acid (SA). Positively regulated by SND1 and homolog proteins. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17890373}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1463302e-90AC146330.33 Medicago truncatula clone mth2-7g7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027342869.15e-40transcription factor MYB46-like
SwissprotQ9LXV23e-34MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A2K3JVU74e-37A0A2K3JVU7_TRIPR; Transcription factor MYB 46-like protein (Fragment)
TrEMBLG7IS017e-37G7IS01_MEDTR; Myb transcription factor
STRINGAES676743e-37(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.16e-35myb domain protein 46
Publications ? help Back to Top
  1. Zhao Q, et al.
    Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis.
    Phytochemistry, 2015. 112: p. 170-8
    [PMID:25107662]
  2. Sakamoto S,Mitsuda N
    Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant.
    Plant Cell Physiol., 2015. 56(2): p. 299-310
    [PMID:25535195]
  3. Vargas L, et al.
    Improving total saccharification yield of Arabidopsis plants by vessel-specific complementation of caffeoyl shikimate esterase (cse) mutants.
    Biotechnol Biofuels, 2016. 9: p. 139
    [PMID:27390589]
  4. Takeuchi M,Kegasa T,Watanabe A,Tamura M,Tsutsumi Y
    Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.
    J. Plant Res., 2018. 131(2): p. 297-305
    [PMID:28921082]