PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA27961 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 83aa MW: 9364.53 Da PI: 4.7392 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.3 | 2e-28 | 14 | 63 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++nrqvtfskRrng+lKKA+EL +LCdaev v+ifsst kly+++s Tp57577_TGAC_v2_mRNA27961 14 RIDNSTNRQVTFSKRRNGLLKKAKELAILCDAEVGVVIFSSTAKLYDFAS 63 8***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.973 | 5 | 65 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.1E-39 | 5 | 64 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.31E-28 | 5 | 65 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.24E-37 | 6 | 64 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 7 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-29 | 7 | 27 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-25 | 14 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-29 | 27 | 42 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-29 | 42 | 63 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
LEIEMGRGKI QIRRIDNSTN RQVTFSKRRN GLLKKAKELA ILCDAEVGVV IFSSTAKLYD 60 FASTRRNFGE VEEEEEEEEV GD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-21 | 5 | 64 | 1 | 60 | MEF2C |
5f28_B | 2e-21 | 5 | 64 | 1 | 60 | MEF2C |
5f28_C | 2e-21 | 5 | 64 | 1 | 60 | MEF2C |
5f28_D | 2e-21 | 5 | 64 | 1 | 60 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA27961 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT485795 | 6e-66 | CT485795.2 Medicago truncatula chromosome 5 clone mte1-33h11, COMPLETE SEQUENCE. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003615360.2 | 2e-34 | MADS-box transcription factor 23 isoform X4 | ||||
Refseq | XP_028802153.1 | 2e-34 | agamous-like MADS-box protein AGL16 isoform X3 | ||||
Swissprot | A2RVQ5 | 1e-31 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
TrEMBL | A0A2K3MTX6 | 1e-38 | A0A2K3MTX6_TRIPR; MADS-box transcription factor 27-like protein (Fragment) | ||||
STRING | AES98316 | 2e-35 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 2e-33 | AGAMOUS-like 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA27961 |
Publications ? help Back to Top | |||
---|---|---|---|
|