PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA26831 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 203aa MW: 23692.3 Da PI: 8.3945 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.9 | 5.5e-28 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++++l +s Tp57577_TGAC_v2_mRNA26831 9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSNRLSHFS 58 79********************************************9997 PP | |||||||
2 | K-box | 21.5 | 9.5e-09 | 143 | 201 | 11 | 69 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 +++ e+lqqe+++L++++++ ++++R + e L+ s+ eL+ e+++ + l ++ ++K Tp57577_TGAC_v2_mRNA26831 143 NSEIEELQQEVSRLQQQLQMAEEQIRIYEPEPLKMTSMAELETSEKNVVETLARVMQRK 201 56789**************************************************9998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 8.5E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.52 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.83E-34 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 5.89E-28 | 2 | 73 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.7E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 6.702 | 146 | 202 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MGRVKLEIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SNRLSHFSGK 60 KRYALIAPYS SYMDFISFIE DVLTRYINLP DNERDNAVSF PELPYRRGIQ NKEYLLRTLQ 120 QLRSENDIAL HMSKFVNIPG DINSEIEELQ QEVSRLQQQL QMAEEQIRIY EPEPLKMTSM 180 AELETSEKNV VETLARVMQR KV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 4e-19 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6byy_B | 4e-19 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6byy_C | 4e-19 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6byy_D | 4e-19 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA26831 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027187592.1 | 1e-114 | agamous-like MADS-box protein AGL104 | ||||
Swissprot | Q1PFC2 | 1e-81 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
TrEMBL | A0A3Q7Y835 | 1e-112 | A0A3Q7Y835_CICAR; agamous-like MADS-box protein AGL104 | ||||
STRING | XP_004490359.1 | 1e-113 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8525 | 27 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77980.1 | 6e-75 | AGAMOUS-like 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA26831 |
Publications ? help Back to Top | |||
---|---|---|---|
|