PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA26199 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 183aa MW: 19740.4 Da PI: 10.8507 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 99.1 | 4.4e-31 | 11 | 66 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 p YVNaKQy++I++RRq+Rak+ ++kl +k +kpy+heSRh hA+rRpRg+gGrF Tp57577_TGAC_v2_mRNA26199 11 GPTYVNAKQYHGIIRRRQSRAKAVLQNKL-IKRNKPYMHESRHLHAMRRPRGCGGRF 66 79***************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.1E-34 | 8 | 69 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 35.25 | 9 | 69 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 3.5E-22 | 12 | 34 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.9E-26 | 12 | 66 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 3.5E-22 | 43 | 66 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MLPLSMTSDD GPTYVNAKQY HGIIRRRQSR AKAVLQNKLI KRNKPYMHES RHLHAMRRPR 60 GCGGRFLNTK ISTDGNGKTG SEMKKKTGGG LQLQSSASQS SEVLQSEVGT LNSLKETNGG 120 SPNVSGSEVT SMYSQGGLDS FAVNHIRSSV HSLGDMVDTG HGIVMPTKWF ATAVTGRQLL 180 QP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-17 | 10 | 70 | 2 | 62 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA26199 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ918266 | 1e-170 | JQ918266.1 Medicago truncatula CCAAT-binding transcription factor, subunit YA (NF-YA1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012570383.2 | 1e-100 | LOW QUALITY PROTEIN: nuclear transcription factor Y subunit A-10 | ||||
Swissprot | Q9M9X4 | 3e-43 | NFYA2_ARATH; Nuclear transcription factor Y subunit A-2 | ||||
TrEMBL | A0A2K3MR82 | 1e-127 | A0A2K3MR82_TRIPR; Nuclear transcription factor Y subunit A-10-like protein | ||||
TrEMBL | A0A2Z6MFZ1 | 1e-128 | A0A2Z6MFZ1_TRISU; Uncharacterized protein | ||||
STRING | XP_004497643.1 | 1e-104 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3794 | 34 | 64 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G05690.1 | 5e-37 | nuclear factor Y, subunit A2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA26199 |
Publications ? help Back to Top | |||
---|---|---|---|
|