PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA19626 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 133aa MW: 15176.2 Da PI: 10.6151 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 113.7 | 1.9e-35 | 16 | 90 | 53 | 128 |
NAM 53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ ewyfFs+rd+ky++g+r+nratksgyWkatgkd++v s + ++vg+kktLv+y+grap+g++t+Wvmheyrl Tp57577_TGAC_v2_mRNA19626 16 GNDMEWYFFSPRDRKYPNGSRTNRATKSGYWKATGKDRKVNS-QARAVGMKKTLVYYRGRAPHGSRTNWVMHEYRL 90 4678**************************************.9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 41.58 | 1 | 113 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.26E-41 | 12 | 113 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.2E-18 | 15 | 90 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
SNPLTLGFTG KSLLPGNDME WYFFSPRDRK YPNGSRTNRA TKSGYWKATG KDRKVNSQAR 60 AVGMKKTLVY YRGRAPHGSR TNWVMHEYRL DERECETTPS LQDAYALCRV IKKNTVIVPK 120 LGGQYSNLTS HAK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-36 | 18 | 115 | 70 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-36 | 18 | 115 | 70 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-36 | 18 | 115 | 70 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-36 | 18 | 115 | 70 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-36 | 18 | 115 | 73 | 170 | NAC domain-containing protein 19 |
3swm_B | 1e-36 | 18 | 115 | 73 | 170 | NAC domain-containing protein 19 |
3swm_C | 1e-36 | 18 | 115 | 73 | 170 | NAC domain-containing protein 19 |
3swm_D | 1e-36 | 18 | 115 | 73 | 170 | NAC domain-containing protein 19 |
3swp_A | 1e-36 | 18 | 115 | 73 | 170 | NAC domain-containing protein 19 |
3swp_B | 1e-36 | 18 | 115 | 73 | 170 | NAC domain-containing protein 19 |
3swp_C | 1e-36 | 18 | 115 | 73 | 170 | NAC domain-containing protein 19 |
3swp_D | 1e-36 | 18 | 115 | 73 | 170 | NAC domain-containing protein 19 |
4dul_A | 1e-36 | 18 | 115 | 70 | 167 | NAC domain-containing protein 19 |
4dul_B | 1e-36 | 18 | 115 | 70 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA19626 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003616168.1 | 3e-79 | NAC domain-containing protein 86 | ||||
Swissprot | Q9FFI5 | 8e-55 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
TrEMBL | A0A2K3NFS8 | 6e-86 | A0A2K3NFS8_TRIPR; NAC domain-containing protein (Fragment) | ||||
STRING | AES99126 | 1e-78 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF21744 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65910.1 | 1e-59 | NAC domain containing protein 28 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA19626 |
Publications ? help Back to Top | |||
---|---|---|---|
|