PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA19445 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 101aa MW: 11637.2 Da PI: 9.9837 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 24.4 | 6.6e-08 | 2 | 37 | 12 | 47 |
HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++ + k++ g Wk+I+r+ k++++ q+ s+ qky Tp57577_TGAC_v2_mRNA19445 2 FLSGLKKYKEGEWKLISRYYVKTKSPTQVASHAQKY 37 78899******************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.79 | 1 | 42 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.79E-8 | 2 | 42 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.53E-4 | 2 | 38 | No hit | No description |
TIGRFAMs | TIGR01557 | 3.3E-8 | 2 | 41 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
SFLSGLKKYK EGEWKLISRY YVKTKSPTQV ASHAQKYFLR KNEANKHKER KRSSIHDITL 60 EDSNSAPTPI DRNCVLPPGV GSLHQSEGMY YFPSNSMQDQ M |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA19445 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013470249.1 | 2e-36 | transcription factor DIVARICATA | ||||
Swissprot | Q9FNN6 | 5e-19 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A392LZ49 | 8e-59 | A0A392LZ49_9FABA; Transcription factor DIVARICATA-like | ||||
STRING | AES84368 | 7e-36 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13860 | 4 | 14 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 8e-23 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA19445 |
Publications ? help Back to Top | |||
---|---|---|---|
|