PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA15636 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 147aa MW: 17300.6 Da PI: 9.9744 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 176.9 | 5.6e-55 | 8 | 137 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksg 81 +ppGfrFhPtdeel+++yLkkkv+ +k+++ +vi+evd++k+ePwdL++k+k ++ewyfFs++d+ky+tg+r+nrat++g Tp57577_TGAC_v2_mRNA15636 8 VPPGFRFHPTDEELLHYYLKKKVAFQKFDM-DVIREVDLNKMEPWDLQEKCKIgstPQNEWYFFSHKDRKYPTGSRTNRATNAG 90 69****************************.99**************964444222455************************* PP NAM 82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +Wkatg+dk + + + +++g++ktLvfykgrap+g+ktdW+mheyrle Tp57577_TGAC_v2_mRNA15636 91 FWKATGRDKCIRN-TYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 137 ************9.8999****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.18E-55 | 7 | 141 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.409 | 8 | 146 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.3E-29 | 9 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048829 | Biological Process | root cap development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MSSSNGGVPP GFRFHPTDEE LLHYYLKKKV AFQKFDMDVI REVDLNKMEP WDLQEKCKIG 60 STPQNEWYFF SHKDRKYPTG SRTNRATNAG FWKATGRDKC IRNTYKKIGM RKTLVFYKGR 120 APHGQKTDWI MHEYRLEDAN DPTNTW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-50 | 2 | 136 | 9 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00431 | DAP | Transfer from AT4G10350 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA15636 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC160842 | 1e-114 | AC160842.52 Medicago truncatula clone mth2-27a2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003605666.1 | 1e-104 | protein BEARSKIN1 | ||||
Swissprot | Q9SV87 | 4e-99 | BRN2_ARATH; Protein BEARSKIN2 | ||||
TrEMBL | G7JRE4 | 1e-103 | G7JRE4_MEDTR; NAC transcription factor-like protein | ||||
STRING | AES87863 | 1e-104 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8752 | 33 | 43 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G10350.1 | 1e-101 | NAC domain containing protein 70 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA15636 |
Publications ? help Back to Top | |||
---|---|---|---|
|