Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 103.3 | 8.6e-33 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
Tp57577_TGAC_v2_mRNA15032 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
79***********************************************96 PP
|
Publications
? help Back to Top |
- Jaillon O, et al.
The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] - Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] - Maejima K, et al.
Recognition of floral homeotic MADS domain transcription factors by a phytoplasmal effector, phyllogen, induces phyllody. Plant J., 2014. 78(4): p. 541-54 [PMID:24597566] - MacLean AM, et al.
Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS Biol., 2014. 12(4): p. e1001835 [PMID:24714165] - Iglesias FM, et al.
The arabidopsis DNA polymerase δ has a role in the deposition of transcriptionally active epigenetic marks, development and flowering. PLoS Genet., 2015. 11(2): p. e1004975 [PMID:25693187] - He Q,Fu AY,Zhang GC,Li TJ,Zhang JH
Arabidopsis thaliana SEPALLATA3 protein prokaryotic expression and purification. Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(2): p. 60-3 [PMID:26025404] - Maejima K, et al.
Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen. Plant Signal Behav, 2015. 10(8): p. e1042635 [PMID:26179462] - Muiño JM, et al.
Evolution of DNA-Binding Sites of a Floral Master Regulatory Transcription Factor. Mol. Biol. Evol., 2016. 33(1): p. 185-200 [PMID:26429922] - Shi Q,Zhou J,Wang P,Lin X,Xu Y
Protein expression and characterization of SEP3 from Arabidopsis thaliana. Genet. Mol. Res., 2015. 14(4): p. 12529-36 [PMID:26505403] - He Q,Fu AY,Zhang GC,Li TJ,Zhang JH
Cloning, Prokaryotic Expression and Purification of CpfS1 Gene from Arabidopsis Thaliana. Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(8): p. 123-7 [PMID:26718440] - Grimplet J,Martínez-Zapater JM,Carmona MJ
Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] - Soza VL,Snelson CD,Hewett Hazelton KD,Di Stilio VS
Partial redundancy and functional specialization of E-class SEPALLATA genes in an early-diverging eudicot. Dev. Biol., 2016. 419(1): p. 143-155 [PMID:27502434] - Conn VM, et al.
A circRNA from SEPALLATA3 regulates splicing of its cognate mRNA through R-loop formation. Nat Plants, 2017. 3: p. 17053 [PMID:28418376] - Käppel S,Melzer R,Rümpler F,Gafert C,Theißen G
The floral homeotic protein SEPALLATA3 recognizes target DNA sequences by shape readout involving a conserved arginine residue in the MADS-domain. Plant J., 2018. 95(2): p. 341-357 [PMID:29744943]
|