PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA11601 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 148aa MW: 16874.1 Da PI: 7.7463 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 121.8 | 3.7e-38 | 5 | 105 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 +CaaCk +rr+C++dC+++pyfp ++p+kfa vh+++G snv k+l++lp+ re+a+++l+ eA++r++dPvyG+vg+i+kl Tp57577_TGAC_v2_mRNA11601 5 RCAACKSQRRRCPSDCIFSPYFPPNDPQKFASVHRIYGGSNVGKMLQQLPHCVREQAANTLYLEAQCRIQDPVYGCVGIISKLY 88 6*********************************************************************************** PP DUF260 85 qqleqlkaelallkeel 101 qq++++++ela++++++ Tp57577_TGAC_v2_mRNA11601 89 QQIHETEVELAKIQTQI 105 ************99885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.047 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.7E-38 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MIYGRCAACK SQRRRCPSDC IFSPYFPPND PQKFASVHRI YGGSNVGKML QQLPHCVREQ 60 AANTLYLEAQ CRIQDPVYGC VGIISKLYQQ IHETEVELAK IQTQIAYYKF QNQQFEAESN 120 LSSLAPQGNN MEMEHFQWPS QALNYSN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-35 | 6 | 108 | 12 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-35 | 6 | 108 | 12 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00381 | DAP | Transfer from AT3G26620 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA11601 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CU179894 | 7e-67 | CU179894.1 Medicago truncatula chromosome 5 clone mth4-21m22, COMPLETE SEQUENCE. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004491406.1 | 1e-83 | LOB domain-containing protein 23-like | ||||
Swissprot | P59468 | 4e-47 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A1S2XPB0 | 3e-82 | A0A1S2XPB0_CICAR; LOB domain-containing protein 23-like | ||||
STRING | XP_004491406.1 | 6e-83 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 2e-49 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA11601 |