PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA11509
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GeBP
Protein Properties Length: 386aa    MW: 43621.4 Da    PI: 4.8713
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA11509genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731253.4e-3990186197
                     DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskeh 84 
                                klfqrlw++eDeiv+LqG++d++a++g+s+++d+  fy+++k++i+++++ksqlv+K+rrLKkK+++ v+k +sgke++f+++h
  Tp57577_TGAC_v2_mRNA11509  90 KLFQRLWTDEDEIVILQGFLDYNANRGSSYHNDTGSFYDQIKSKIQLDFNKSQLVDKLRRLKKKYRNVVQKFDSGKEFVFKTPH 173
                                579********************************************************************************* PP

                     DUF573  85 dqkifelskkiWg 97 
                                dq +fe+s+kiW+
  Tp57577_TGAC_v2_mRNA11509 174 DQATFEISHKIWK 186
                                ************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-3492186IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MAAFFQNGVV SPKQEFVQFQ PEYEEEEEVE QEQFDEVLVE PDEINETEQS PSSAVPTVIL  60
ALPNATAATV VTDSPEPKRD QMEEKNDSRK LFQRLWTDED EIVILQGFLD YNANRGSSYH  120
NDTGSFYDQI KSKIQLDFNK SQLVDKLRRL KKKYRNVVQK FDSGKEFVFK TPHDQATFEI  180
SHKIWKNVAP IAVGVPVEDD EEISPNPNSA HMTTPVKNEL IIEKKTASRK RSRTTTDEKR  240
ELNDSLGLNN KDNHNNSANN NSSNVDDENA DKSNVSHHTH NIPGLIEETV KSCLTPVLKE  300
LSSRNTMGSP FGFGGRGFSL DPMPFSFMNF GNGEKVLDDK WKKQRILELE VYSKRLELVQ  360
DEIKVALEEL RSSSGAGARG GNNHQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA11509
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012569933.11e-138probable transcription factor At5g28040
TrEMBLA0A2K3NPC00.0A0A2K3NPC0_TRIPR; DNA-binding storekeeper transcriptional regulator
STRINGAES612831e-140(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32553365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.26e-48DNA-binding storekeeper protein-related transcriptional regulator