PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp7g08810 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 146aa MW: 16295.4 Da PI: 10.6354 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.6 | 3.8e-15 | 106 | 146 | 1 | 43 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 +++WTteE+ l +a +++G++ W+ Ia+ ++ gRt++ +k++ Tp7g08810 106 KDAWTTEEESALMNAQRMHGNK-WTEIAKVLN-GRTDNAIKNH 146 689*******************.*********.*********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 6.13E-18 | 89 | 146 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.2E-5 | 89 | 113 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.037 | 101 | 146 | IPR017930 | Myb domain |
SMART | SM00717 | 2.5E-5 | 105 | 146 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.0E-13 | 106 | 146 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.20E-10 | 108 | 146 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.0E-14 | 114 | 146 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MRSNSNPATG SPEKEERSEL KVEIHCMENK QPTPASCSSA SEGSGNFFLK SPEIATPAAT 60 SSPTPRRTSG PMRRAKGGKK VWTCQMVCNR KVFTRWHNRL NPGIRKDAWT TEEESALMNA 120 QRMHGNKWTE IAKVLNGRTD NAIKNH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-16 | 95 | 146 | 48 | 99 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp7g08810 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006287439.1 | 6e-48 | transcription factor MYB3R-5 | ||||
Swissprot | Q6R032 | 7e-49 | MB3R5_ARATH; Transcription factor MYB3R-5 | ||||
TrEMBL | R0FDT2 | 1e-46 | R0FDT2_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.6251s0040.1.p | 2e-48 | (Boechera stricta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02320.2 | 3e-51 | myb domain protein 3r-5 |
Publications ? help Back to Top | |||
---|---|---|---|
|