PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp7g01580 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 216aa MW: 24579.5 Da PI: 7.087 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.4 | 1.5e-17 | 19 | 66 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++l+++++ +G g W++ a+ g++Rt+k+c++rw++yl Tp7g01580 19 KGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYL 66 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.7 | 9.6e-17 | 72 | 115 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++++ ++++++G++ W++Ia++++ gRt++++k++w++ Tp7g01580 72 RGNITAEEQLIIMELHAKWGNR-WSKIAQHLP-GRTDNEIKNFWRT 115 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.917 | 14 | 66 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-23 | 14 | 69 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.35E-29 | 17 | 113 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.1E-13 | 18 | 68 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-16 | 19 | 66 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.74E-10 | 21 | 66 | No hit | No description |
PROSITE profile | PS51294 | 23.797 | 67 | 121 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-23 | 70 | 120 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-14 | 71 | 119 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-15 | 72 | 115 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.66E-11 | 76 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0080086 | Biological Process | stamen filament development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MEKSKSSGGS GSGDAEVRKG PWTMEEDLIL INYIANHGEG VWNSLAKSAG LKRTGKSCRL 60 RWLNYLRPDV RRGNITAEEQ LIIMELHAKW GNRWSKIAQH LPGRTDNEIK NFWRTKIQKY 120 IIKQGETTNV GSQSSEIIND HATSTSHHVL NNQEAMVLYS PTTSYQHVNT IDHHQLNYGN 180 YVPSSDSIMM PLSVDQSEEN YWTVDDLWPM HLLSGN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-25 | 14 | 121 | 22 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor acting redundantly with MYB21 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB21 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:16972096, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21447791}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp7g01580 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by jasmonate. {ECO:0000269|PubMed:16805732}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF175987 | 0.0 | AF175987.1 Arabidopsis thaliana putative transcription factor (MYB24) mRNA, complete cds. | |||
GenBank | AY519632 | 0.0 | AY519632.1 Arabidopsis thaliana MYB transcription factor (At5g40350) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006405505.1 | 1e-133 | transcription factor MYB24 | ||||
Swissprot | Q9SPG9 | 1e-126 | MYB24_ARATH; Transcription factor MYB24 | ||||
TrEMBL | V4M3Y1 | 1e-132 | V4M3Y1_EUTSA; Uncharacterized protein | ||||
STRING | Bostr.7200s0008.1.p | 1e-137 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40350.1 | 1e-127 | myb domain protein 24 |
Publications ? help Back to Top | |||
---|---|---|---|
|