PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp6g37130

Organism

Thellungiella parvula

Taxonomic ID

98039

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella

Family

WOX

Protein Properties

Length: 188aa MW: 21330.1 Da PI: 10.1968

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp6g37130	genome	thellungiella	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	63.4	3.3e-20	26	87	1	57
TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++ R+++t eq+++L +lF+ r+ps++++++++++l +++ ++V++WFqN++a+e++ Tp6g37130 26 KCGRWNPTVEQVKVLTDLFKAgLRTPSTDQIQKISTELsfygKIESKNVFYWFQNHKARERQ 87 568***************99************************************97 PP
2	Wus_type_Homeobox	112.9	1.6e-36	26	89	2	65
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 ++ RW+Pt eQ+k+L++l+k+GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+ Tp6g37130 26 KCGRWNPTVEQVKVLTDLFKAGLRTPSTDQIQKISTELSFYGKIESKNVFYWFQNHKARERQKR 89 678***********************************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	10.625	23	88	IPR001356	Homeobox domain
SMART	SM00389	4.7E-4	25	92	IPR001356	Homeobox domain
Pfam	PF00046	2.9E-17	27	87	IPR001356	Homeobox domain
SuperFamily	SSF46689	4.28E-11	28	91	IPR009057	Homeodomain-like
CDD	cd00086	8.40E-5	29	89	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.6E-8	29	87	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 188 aa Download sequence Send to blast
MSSGGFSTKA RGLGNSNVGG VGTGTKCGRW NPTVEQVKVL TDLFKAGLRT PSTDQIQKIS 60 TELSFYGKIE SKNVFYWFQN HKARERQKRR KISTVDFDHR QDTNLTLPRQ HNPRHHQPPP 120 KACEEKEKVI ETLQLFPLSK VERARANITA ATHNEYIRDQ ANTTVFSTYS SCGAEMEHPP 180 LDLRLSFL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor, which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269\|PubMed:25631790}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp6g37130

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009122174.1	1e-112	PREDICTED: WUSCHEL-related homeobox 7
Refseq	XP_013610643.1	1e-112	PREDICTED: WUSCHEL-related homeobox 7
Swissprot	Q8H1D2	4e-77	WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBL	A0A0D3EHJ7	1e-111	A0A0D3EHJ7_BRAOL; Uncharacterized protein
TrEMBL	A0A3N6RNW0	1e-111	A0A3N6RNW0_BRACR; Uncharacterized protein
TrEMBL	A0A3P6DSM2	1e-111	A0A3P6DSM2_BRAOL; Uncharacterized protein
TrEMBL	M4CY35	1e-111	M4CY35_BRARP; Uncharacterized protein
STRING	Bra009132.1-P	1e-111	(Brassica rapa)
STRING	Bo9g176920.1	1e-111	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4014	28	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G11260.1	1e-72	WUSCHEL related homeobox 5

Publications ? help Back to Top
Conte MG,Gaillard S,Droc G,Perin C Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants. BMC Genomics, 2008. 9: p. 183 [PMID:18426584] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Tian H,Niu T,Yu Q,Quan T,Ding Z Auxin gradient is crucial for the maintenance of root distal stem cell identity in Arabidopsis. Plant Signal Behav, 2013. 8(12): p. e26429 [PMID:24056047] Tian H,Jia Y,Niu T,Yu Q,Ding Z The key players of the primary root growth and development also function in lateral roots in Arabidopsis. Plant Cell Rep., 2014. 33(5): p. 745-53 [PMID:24504658] Reyes-Hernández BJ, et al. The root indeterminacy-to-determinacy developmental switch is operated through a folate-dependent pathway in Arabidopsis thaliana. New Phytol., 2014. 202(4): p. 1223-36 [PMID:24635769] Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342] Ji H, et al. PRL1 modulates root stem cell niche activity and meristem size through WOX5 and PLTs in Arabidopsis. Plant J., 2015. 81(3): p. 399-412 [PMID:25438658] Su YH,Liu YB,Bai B,Zhang XS Establishment of embryonic shoot-root axis is involved in auxin and cytokinin response during Arabidopsis somatic embryogenesis. Front Plant Sci, 2014. 5: p. 792 [PMID:25642237] Jia Y, et al. The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development. J. Exp. Bot., 2015. 66(15): p. 4631-42 [PMID:25998905] Zhang M, et al. A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis. Plant J., 2015. 83(4): p. 582-99 [PMID:26072661] Kong X,Lu S,Tian H,Ding Z WOX5 is Shining in the Root Stem Cell Niche. Trends Plant Sci., 2015. 20(10): p. 601-603 [PMID:26440429] Hu X,Xu L Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis. Plant Physiol., 2016. 172(4): p. 2363-2373 [PMID:27784768] Zhang Y,Jiao Y,Jiao H,Zhao H,Zhu YX Two-Step Functional Innovation of the Stem-Cell Factors WUS/WOX5 during Plant Evolution. Mol. Biol. Evol., 2017. 34(3): p. 640-653 [PMID:28053005] Singh S, et al. Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components. Sci Rep, 2017. 7: p. 42450 [PMID:28195159] García-Gómez ML,Azpeitia E,Álvarez-Buylla ER A dynamic genetic-hormonal regulatory network model explains multiple cellular behaviors of the root apical meristem of Arabidopsis thaliana. PLoS Comput. Biol., 2017. 13(4): p. e1005488 [PMID:28426669] Long Y, et al. In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots. Nature, 2017. 548(7665): p. 97-102 [PMID:28746306] Bruno L, et al. In Arabidopsis thaliana Cadmium Impact on the Growth of Primary Root by Altering SCR Expression and Auxin-Cytokinin Cross-Talk. Front Plant Sci, 2017. 8: p. 1323 [PMID:28798767] Hu B, et al. Divergent regeneration-competent cells adopt a common mechanism for callus initiation in angiosperms. Regeneration (Oxf), 2017. 4(3): p. 132-139 [PMID:28975033] Lozano-Elena F,Planas-Riverola A,Vilarrasa-Blasi J,Schwab R,Caño-Delgado AI Paracrine brassinosteroid signaling at the stem cell niche controls cellular regeneration. J. Cell. Sci., 2019. [PMID:29242230] Xu C, et al. Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration. Nat Plants, 2018. 4(2): p. 108-115 [PMID:29358751] Dolzblasz A, et al. Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4. Int J Mol Sci, 2018. [PMID:29538317]