PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g28260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family CO-like
Protein Properties Length: 360aa    MW: 40100.3 Da    PI: 6.9238
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g28260genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.32.4e-061254440
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               + C+++ +   + +C+ ++ +lC +C  + H        H++v
  Tp6g28260 12 QACDTCRSAACTVYCRADSAYLCTNCDAQVHAAnrvasrHERV 54
               57******99*********************556677778776 PP

2zf-B_box34.73.8e-115499342
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                r+C+ +e+ ++ +fC+ +   lC  C +++H+       H++vp+
  Tp6g28260 54 VRVCESCERAPAAFFCKADAASLCTACDSHIHSAnplarrHQRVPI 99
               689*****************************66899999**9997 PP

3CCT67.44e-23291335145
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  Tp6g28260 291 REARVLRYREKKKTRKFEKTIRYASRKAYAEKRPRIKGRFAKRKE 335
                9*****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.865956IPR000315B-box-type zinc finger
SMARTSM003364.1E-8956IPR000315B-box-type zinc finger
CDDcd000216.68E-81456No hitNo description
PROSITE profilePS5011912.3015299IPR000315B-box-type zinc finger
PfamPF006439.5E-95499IPR000315B-box-type zinc finger
CDDcd000216.35E-105599No hitNo description
SMARTSM003363.7E-125799IPR000315B-box-type zinc finger
PROSITE profilePS5101716.668291333IPR010402CCT domain
PfamPF062034.0E-17291333IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MLKQESSSNW AQACDTCRSA ACTVYCRADS AYLCTNCDAQ VHAANRVASR HERVRVCESC  60
ERAPAAFFCK ADAASLCTAC DSHIHSANPL ARRHQRVPIL PISVNSYGSM ATIHSSETTV  120
TTGPENRVVV GQEEEDEDED EAEAASWLLP SSWKNSGNNN NSQNNGFSIG DEYLDLVDYN  180
SSSDKQFTDQ SNQYQQDYNL PQRSYGGDGV VPLQVEASKR HMPHEQHNFQ FGFTNVCSGP  240
HRSSNGSLSH MVSLVAESTT SDTTVSHPRS PKAATDQLPE PPTQMLSPMD REARVLRYRE  300
KKKTRKFEKT IRYASRKAYA EKRPRIKGRF AKRKEVDAEA DQAFSTTIMF DTGYGIVPSF
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp6g28260
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2401010.0AC240101.1 Sisymbrium irio clone SIR-39M12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400111.10.0zinc finger protein CONSTANS-LIKE 1
SwissprotO500550.0COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLA0A087G7H10.0A0A087G7H1_ARAAL; Uncharacterized protein
STRINGA0A087G7H10.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-160CONSTANS-like 1
Publications ? help Back to Top
  1. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]
  2. An C, et al.
    Mediator subunit MED25 links the jasmonate receptor to transcriptionally active chromatin.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(42): p. E8930-E8939
    [PMID:28973940]
  3. Ordoñez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]