PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp6g16960 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 102aa MW: 11119.6 Da PI: 10.7681 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.1 | 7.3e-17 | 30 | 77 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ede+l+ +v++ G g+W+++ + g+ R++k+c++rw ++l Tp6g16960 30 KGPWTAAEDEILAAYVRENGEGNWNAVQKNTGLARCGKSCRLRWANHL 77 79******************************************9996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.069 | 25 | 81 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-21 | 28 | 85 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-12 | 29 | 79 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-15 | 30 | 77 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.58E-17 | 31 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.28E-9 | 32 | 77 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MILYGGGAGK DGGSTNHISD GGGGGVVLKK GPWTAAEDEI LAAYVRENGE GNWNAVQKNT 60 GLARCGKSCR LRWANHLRPN LKKRLFHRRR RTSHYPASCS AW |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 81 | 90 | KKRLFHRRRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp6g16960 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269|PubMed:19714218}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189303 | 1e-115 | AC189303.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB030F12, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018475832.1 | 8e-45 | PREDICTED: transcription factor MYB86 | ||||
Swissprot | Q94FL7 | 6e-40 | MY120_ARATH; Transcription factor MYB120 | ||||
TrEMBL | A0A078J922 | 9e-44 | A0A078J922_BRANA; BnaC03g71630D protein | ||||
STRING | Bra028997.1-P | 1e-43 | (Brassica rapa) | ||||
STRING | A0A087GB55 | 9e-44 | (Arabis alpina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G55020.1 | 2e-34 | myb domain protein 120 |
Publications ? help Back to Top | |||
---|---|---|---|
|