PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp6g12060 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 103aa MW: 12007.5 Da PI: 6.2547 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 36 | 1.8e-11 | 14 | 56 | 2 | 44 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpky 44 + +kl+e+++d+++++++sws++gnsf+v++e+ef +vLp++ Tp6g12060 14 YFRKLFEMVDDHSTDSIVSWSDSGNSFIVWNESEFCGNVLPSF 56 578*************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.0E-12 | 7 | 57 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 3.6E-4 | 10 | 100 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 6.26E-11 | 12 | 57 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 2.3E-9 | 15 | 60 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MDLDSNHKHR YNRYFRKLFE MVDDHSTDSI VSWSDSGNSF IVWNESEFCG NVLPSFLPFK 60 EIAPPELEPP PEAFVYQRPS EAESARAVER LKKLATAMRK RQS |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp6g12060 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002873596.2 | 1e-16 | heat stress transcription factor A-4a | ||||
TrEMBL | A0A1J3H8M8 | 1e-33 | A0A1J3H8M8_NOCCA; Heat stress transcription factor A-4b | ||||
STRING | Bostr.3359s0057.1.p | 9e-22 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13231 | 11 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77570.1 | 2e-13 | Winged helix-turn-helix transcription repressor DNA-binding |