PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp4g29730 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 161aa MW: 18409.7 Da PI: 6.8792 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 170.1 | 2.5e-53 | 46 | 141 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisf+t+easdkc++ekrk +ngdd++wa+a+lGf+dy+e+lk+yl++yr +ege+ Tp4g29730 46 KEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFITGEASDKCHKEKRKNVNGDDICWAMANLGFDDYAEQLKKYLMRYRVIEGER 141 89*******************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.4E-52 | 38 | 155 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.43E-38 | 48 | 156 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.0E-26 | 51 | 115 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.5E-18 | 79 | 97 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 82 | 98 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.5E-18 | 98 | 116 | No hit | No description |
PRINTS | PR00615 | 2.5E-18 | 117 | 135 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MAGNYPSFQN PIPRFQNYNF GSSSSQHQHH GLVVEDQQQE ENMMIKEQDR LLPIANVGRI 60 MKNILPPNAK ISKEAKETMQ ECVSEFISFI TGEASDKCHK EKRKNVNGDD ICWAMANLGF 120 DDYAEQLKKY LMRYRVIEGE RANHHGKGGT KASPDNQHID Q |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 9e-44 | 45 | 135 | 1 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 9e-44 | 45 | 135 | 1 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp4g29730 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC787665 | 1e-157 | KC787665.1 Brassica napus transcription factor subunit NF-YB5 (NF-YB5) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018474925.1 | 1e-104 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 1e-101 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1J3F499 | 1e-104 | A0A1J3F499_NOCCA; Nuclear transcription factor Y subunit B-5 | ||||
STRING | Bo3g039790.1 | 1e-101 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 4e-97 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|