PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp4g25130 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 279aa MW: 32215.3 Da PI: 7.9667 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 161.8 | 2.5e-50 | 17 | 141 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101 pGfrFhPtdeel+ +yL++kve+k+++l e ik++diyk++PwdLp+ + +ekewyfF+ r +ky+++ r+nr+t sg+Wkatg dk+v+s + vg Tp4g25130 17 LPGFRFHPTDEELLGYYLRRKVENKPIKL-ELIKQIDIYKFDPWDLPRVSSVGEKEWYFFCMRGRKYKNSVRPNRVTGSGFWKATGIDKPVYS-NLDCVG 114 69***************************.99***************7777799***************************************.9999** PP NAM 102 lkktLvfykgrapkgektdWvmheyrl 128 lkk+Lv+y g+a kg+ktdW+mhe+rl Tp4g25130 115 LKKSLVYYLGSAGKGSKTDWMMHEFRL 141 *************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.18E-56 | 16 | 164 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.859 | 16 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.7E-25 | 18 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005992 | Biological Process | trehalose biosynthetic process | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006561 | Biological Process | proline biosynthetic process | ||||
GO:0009718 | Biological Process | anthocyanin-containing compound biosynthetic process | ||||
GO:0010120 | Biological Process | camalexin biosynthetic process | ||||
GO:0042538 | Biological Process | hyperosmotic salinity response | ||||
GO:1900056 | Biological Process | negative regulation of leaf senescence | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 279 aa Download sequence Send to blast |
MSGEGNKDHE EEDETTLPGF RFHPTDEELL GYYLRRKVEN KPIKLELIKQ IDIYKFDPWD 60 LPRVSSVGEK EWYFFCMRGR KYKNSVRPNR VTGSGFWKAT GIDKPVYSNL DCVGLKKSLV 120 YYLGSAGKGS KTDWMMHEFR LPSTTKTDSP AQQAEVWTLC RIFKRVTHVH HRNPTIVQPH 180 RKPVITLTDS CSKTSSLDSD HTSHRVVDSL SHKLHEPPFQ PQIENPYWNQ HTVGFNQPTY 240 TCYDNNLLSF WNINGGDVIG DAASWDELRS VIDGNTKHL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-53 | 18 | 170 | 19 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-53 | 18 | 170 | 19 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-53 | 18 | 170 | 19 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-53 | 18 | 170 | 19 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-53 | 18 | 170 | 22 | 173 | NAC domain-containing protein 19 |
3swm_B | 4e-53 | 18 | 170 | 22 | 173 | NAC domain-containing protein 19 |
3swm_C | 4e-53 | 18 | 170 | 22 | 173 | NAC domain-containing protein 19 |
3swm_D | 4e-53 | 18 | 170 | 22 | 173 | NAC domain-containing protein 19 |
3swp_A | 4e-53 | 18 | 170 | 22 | 173 | NAC domain-containing protein 19 |
3swp_B | 4e-53 | 18 | 170 | 22 | 173 | NAC domain-containing protein 19 |
3swp_C | 4e-53 | 18 | 170 | 22 | 173 | NAC domain-containing protein 19 |
3swp_D | 4e-53 | 18 | 170 | 22 | 173 | NAC domain-containing protein 19 |
4dul_A | 4e-53 | 18 | 170 | 19 | 170 | NAC domain-containing protein 19 |
4dul_B | 4e-53 | 18 | 170 | 19 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00310 | DAP | Transfer from AT2G43000 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp4g25130 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM975669 | 0.0 | KM975669.1 Brassica napus NAC transcription factor 42.1 (NAC42.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009142151.1 | 0.0 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
Swissprot | Q9SK55 | 1e-179 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | A0A078H0L4 | 0.0 | A0A078H0L4_BRANA; BnaA04g24740D protein | ||||
TrEMBL | A0A397ZQL5 | 0.0 | A0A397ZQL5_BRACM; Uncharacterized protein | ||||
TrEMBL | M4F9I0 | 0.0 | M4F9I0_BRARP; Uncharacterized protein | ||||
STRING | Bra037743.1-P | 0.0 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM306 | 28 | 200 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G43000.1 | 0.0 | NAC domain containing protein 42 |