PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp3g27050 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 177aa MW: 20988.7 Da PI: 9.1376 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 38 | 3.7e-12 | 29 | 74 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W Ede l +++ q+G+++W+ I++++ gR+ k+ ++rw++ Tp3g27050 29 RGHWNLMEDENLRKLILQYGPKNWNFISEYFE-GRSTKSYRLRWYNQ 74 899*****************************.************96 PP | |||||||
2 | Myb_DNA-binding | 38.2 | 3.2e-12 | 87 | 126 | 6 | 47 |
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +eE++ l++a++ ++ W++Ia+ ++ +Rt++ +k+++++ Tp3g27050 87 EEEEDMLLKAHAIQRNR-WDSIAKNFP-RRTDNAVKNHFYTI 126 567789***********.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.312 | 24 | 79 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-9 | 28 | 77 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.64E-21 | 29 | 127 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.1E-19 | 30 | 82 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.77E-9 | 32 | 73 | No hit | No description |
Pfam | PF13921 | 1.9E-12 | 32 | 91 | No hit | No description |
SMART | SM00717 | 7.2E-10 | 80 | 129 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 11.617 | 80 | 131 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-17 | 83 | 129 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.69E-6 | 91 | 127 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MVRDRESLVV STEVSEGSNG CENNKSCQRG HWNLMEDENL RKLILQYGPK NWNFISEYFE 60 GRSTKSYRLR WYNQLDPKLK EKPFTEEEEE DMLLKAHAIQ RNRWDSIAKN FPRRTDNAVK 120 NHFYTIMARR KCEGSVTNTS YNLPSLNNLY FGFGRYCIKY TQNVLAPCSS WIFFGLK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-24 | 29 | 130 | 4 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 4e-24 | 24 | 130 | 53 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 4e-24 | 24 | 130 | 53 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 9e-25 | 29 | 130 | 4 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 9e-25 | 29 | 130 | 4 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp3g27050 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002885886.1 | 1e-66 | transcription factor MYB117 | ||||
Swissprot | Q6R0C4 | 2e-40 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | D7L045 | 3e-65 | D7L045_ARALL; Uncharacterized protein | ||||
STRING | scaffold_303564.1 | 5e-66 | (Arabidopsis lyrata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G33450.1 | 8e-54 | myb domain protein 69 |
Publications ? help Back to Top | |||
---|---|---|---|
|