PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp3g21800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 158aa MW: 18349.5 Da PI: 8.2023 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 21.8 | 3.4e-07 | 75 | 104 | 1 | 30 |
CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS HLH 1 rrrahnerErrRRdriNsafeeLrellPka 30 +r++h + r+RR+++N+ f Lr+ +P + Tp3g21800 75 QRMTHIVVKRNRRKQMNDHFRVLRSPMPGS 104 79**********************999975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00083 | 1.78E-5 | 73 | 105 | No hit | No description |
Gene3D | G3DSA:4.10.280.10 | 6.5E-6 | 73 | 106 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 4.32E-7 | 73 | 105 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
PROSITE profile | PS50888 | 8.626 | 74 | 127 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MSQEGSECEG NISDLCFKEK EDQYGHNDTT QCNFRLIGGE KEKDKGEQEC YDKGGEEQKM 60 KRGRTSKTSK EAESQRMTHI VVKRNRRKQM NDHFRVLRSP MPGSYAKYRQ WFRVEEDGDA 120 YADTYMHTPK VNKKNGGGLN WAEDKMFIGL GFRVLCTD |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 75 | 86 | RMTHIVVKRNRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:17088607, PubMed:17183265, PubMed:17183267). Together with MYB88 and MYB124, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Together with SPCH and MUTE, regulates the stomata formation. Required to promote differentiation and morphogenesis of stomatal guard cells and to halt proliferative divisions in their immediate precursors. Mediates the formation of stomata (PubMed:17088607, PubMed:17183265, PubMed:17183267). Prevents histone H3K27me3 marks and derepresses stem cell gene expression (PubMed:24654956). {ECO:0000269|PubMed:17088607, ECO:0000269|PubMed:17183265, ECO:0000269|PubMed:17183267, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp3g21800 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Inhibited by low relative humidity (LRH) via epigenetic CG methylation, thus leading to a reduced stomatal index. {ECO:0000269|PubMed:22442411}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013724461.1 | 2e-32 | transcription factor FAMA-like | ||||
Refseq | XP_013724462.1 | 2e-32 | transcription factor FAMA-like | ||||
Refseq | XP_013730367.1 | 9e-33 | transcription factor FAMA-like isoform X2 | ||||
Swissprot | Q56YJ8 | 4e-27 | FAMA_ARATH; Transcription factor FAMA | ||||
TrEMBL | A0A3P6G4Q6 | 4e-31 | A0A3P6G4Q6_BRAOL; Uncharacterized protein (Fragment) | ||||
STRING | Bra028357.1-P | 4e-31 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10389 | 25 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24140.1 | 3e-25 | bHLH family protein |