PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g01430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family CO-like
Protein Properties Length: 353aa    MW: 39105.4 Da    PI: 6.0455
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g01430genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.52.1e-061456440
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               r C+++ +   + +Ce ++ +lC +C    H+       H++v
  Tp3g01430 14 RACDTCRSAACTVYCEADSAYLCTTCDARVHSAnllasrHERV 56
               57******99*******************9*667888888876 PP

2zf-B_box31.63.4e-1056101342
   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                 r+C+ +e+ ++ + C+ +   lC  C  e+H+       H++vp+
  Tp3g01430  56 VRVCQSCESAPAAFLCRADAASLCTACDAEIHSAnplarrHQRVPI 101
                689*****************************66899999**9997 PP

3CCT67.63.4e-23283325143
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae RpR+KGrF+k+
  Tp3g01430 283 REARVLRYREKKKTRKFEKTIRYASRKAYAEIRPRIKGRFAKR 325
                9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.6E-91158IPR000315B-box-type zinc finger
PROSITE profilePS5011910.5371158IPR000315B-box-type zinc finger
CDDcd000211.12E-71458No hitNo description
PROSITE profilePS5011911.70454101IPR000315B-box-type zinc finger
PfamPF006436.6E-856101IPR000315B-box-type zinc finger
CDDcd000211.09E-857101No hitNo description
SMARTSM003363.7E-1159101IPR000315B-box-type zinc finger
PfamPF062037.1E-17283325IPR010402CCT domain
PROSITE profilePS5101716.42283325IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MLKEESNESG TWARACDTCR SAACTVYCEA DSAYLCTTCD ARVHSANLLA SRHERVRVCQ  60
SCESAPAAFL CRADAASLCT ACDAEIHSAN PLARRHQRVP ILPISADSCS SMVTDADNNG  120
MVVSKEDDED EVASWLMLNP GKNSSNHNNG FLFGVEYLDL VDYSSSMDNQ FEDQYSHYQR  180
SFGGEDGVVP LHLEESTSHL QQSQHNFHLG INYGCSSGAH YNYNGSLKDL NHAVSVSSVD  240
ISAVPESTAS DTTFQHPRAP KETIDQLSGP PAQMAQQLTP MDREARVLRY REKKKTRKFE  300
KTIRYASRKA YAEIRPRIKG RFAKRIEIEA DAEQLFSTSL MSNTTGYGIV PSF
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp3g01430
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010485482.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965020.0COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLI3RT180.0I3RT18_ARALL; Putative flowering-time constans protein
STRINGXP_010485482.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.10.0CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]