PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp3g00600 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 218aa MW: 24710.4 Da PI: 5.1754 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 57.1 | 3e-18 | 19 | 62 | 13 | 56 |
HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 + Le+ Fe ++++ e++++LAkklgL+ rqV vWFqNrRa++k Tp3g00600 19 HLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 62 67*****************************************9 PP | |||||||
2 | HD-ZIP_I/II | 120.7 | 7.3e-39 | 18 | 100 | 11 | 93 |
HD-ZIP_I/II 11 vklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 v+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+d++ Lk++yd+l ++ +++ ke+++Lr+++++ Tp3g00600 18 VHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDFDLLKSTYDQLLSNYDSIVKENDKLRSQVTS 100 789****************************************************************************9975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00389 | 9.8E-16 | 6 | 68 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 6.42E-17 | 17 | 73 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.98E-15 | 18 | 65 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.2E-20 | 18 | 71 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 2.1E-15 | 19 | 62 | IPR001356 | Homeobox domain |
PROSITE profile | PS50071 | 15.661 | 21 | 64 | IPR001356 | Homeobox domain |
PRINTS | PR00031 | 2.8E-6 | 35 | 44 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 39 | 62 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 2.8E-6 | 44 | 60 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 2.8E-16 | 64 | 105 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001558 | Biological Process | regulation of cell growth | ||||
GO:0009637 | Biological Process | response to blue light | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MAKENGPHQA QKGPLQIVHL LEKSFETENK LEPERKTQLA KKLGLQPRQV AVWFQNRRAR 60 WKTKQLERDF DLLKSTYDQL LSNYDSIVKE NDKLRSQVTS LAEKLRGKDE TANEPPGQVP 120 EANQVDPVNM NRFEPAMKTE DRLSSGSVGS AVLDEDAPQL LDSCDSYFPS IVPIHSEEYN 180 NNKNNGSDND RSCFADVFVP TTSPSHDHGE PLGFWGWT |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 56 | 64 | RRARWKTKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00323 | DAP | Transfer from AT3G01470 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp3g00600 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK352854 | 0.0 | AK352854.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-08-H09. | |||
GenBank | AK353535 | 0.0 | AK353535.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-50-D05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006408508.2 | 1e-128 | homeobox-leucine zipper protein HAT5 | ||||
Swissprot | Q02283 | 1e-117 | HAT5_ARATH; Homeobox-leucine zipper protein HAT5 | ||||
TrEMBL | V4NTB7 | 1e-127 | V4NTB7_EUTSA; Uncharacterized protein | ||||
STRING | XP_006408508.1 | 1e-128 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8884 | 27 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01470.1 | 1e-118 | homeobox 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|