PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp2g28130 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 177aa MW: 19770.8 Da PI: 10.4472 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 67.9 | 1e-21 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 krienks rqvtfskRrng++ KA LS+LC+ vav+++s++gkly Tp2g28130 9 KRIENKSSRQVTFSKRRNGLIEKARQLSILCESSVAVLVVSTSGKLYN 56 79********************************************97 PP | |||||||
2 | K-box | 32.4 | 3.9e-12 | 78 | 145 | 31 | 98 |
K-box 31 LqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 L++ + +l ++++ s+ L +L +qLe++l+ R++K+el +e +++lq+kek l+een L +++ Tp2g28130 78 LESVKSNLEEANVDNVSVDSLISLGEQLETALSITRARKTELRMECVKTLQEKEKLLREENLVLATQI 145 5555566666788999*********************************************9999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.076 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.5E-24 | 1 | 72 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.8E-31 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.9E-21 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.001 | 61 | 151 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.5E-8 | 78 | 145 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010048 | Biological Process | vernalization response | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MGRRKVEIKR IENKSSRQVT FSKRRNGLIE KARQLSILCE SSVAVLVVST SGKLYNSSSG 60 DKILRKKTRN YLPHKELLES VKSNLEEANV DNVSVDSLIS LGEQLETALS ITRARKTELR 120 MECVKTLQEK EKLLREENLV LATQIGKTTF LVTEGEGRTS PANSSGNKPP ETLSLLK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 1e-17 | 1 | 82 | 1 | 89 | MEF2 CHIMERA |
6byy_B | 1e-17 | 1 | 82 | 1 | 89 | MEF2 CHIMERA |
6byy_C | 1e-17 | 1 | 82 | 1 | 89 | MEF2 CHIMERA |
6byy_D | 1e-17 | 1 | 82 | 1 | 89 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. Landsberg erecta than in cv. Columbia background. Prevents premature flowering (PubMed:12724541, PubMed:25339407). Involved in the modulation of vernalization impact on flowering according to genotype acclimation to altitude (PubMed:25339407). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:25339407}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp2g28130 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed during vernalization (PubMed:12724541). Regulated by HAM1 and HAM2 via epigenetic modification of chromatins at H4K5 acetylation during flowering (PubMed:23273925). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:23273925}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024007051.1 | 2e-92 | LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL27 | ||||
Swissprot | Q9LSR7 | 2e-86 | AGL70_ARATH; Agamous-like MADS-box protein AGL70 | ||||
TrEMBL | E4MW80 | 7e-91 | E4MW80_EUTHA; mRNA, clone: RTFL01-07-K22 | ||||
STRING | A0A087GE89 | 2e-87 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM986 | 19 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65060.1 | 6e-89 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|