PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010559136.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 218aa MW: 25250.9 Da PI: 10.4203 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.1 | 3.7e-17 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgrW+ Ed ll d+v+ +G g+Wk+ +++ g+ R++k+c++rw++yl XP_010559136.1 16 RGRWSSKEDRLLSDYVRTHGEGRWKSLPKKAGLLRCGKSCRLRWLNYL 63 8*******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 54.5 | 2.8e-17 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ T+eE++++v+++k+ G++ W++Ia +++ gRt++++k++w+++l XP_010559136.1 69 RGNITPEEEDIIVRLHKLIGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 114 7999******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.041 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.14E-28 | 13 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-12 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.4E-15 | 16 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-23 | 17 | 70 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.28E-9 | 18 | 63 | No hit | No description |
PROSITE profile | PS51294 | 25.77 | 64 | 118 | IPR017930 | Myb domain |
SMART | SM00717 | 4.7E-16 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.2E-15 | 69 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-26 | 71 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.88E-11 | 73 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MGRSRRRAEE EVGLRRGRWS SKEDRLLSDY VRTHGEGRWK SLPKKAGLLR CGKSCRLRWL 60 NYLRPDIKRG NITPEEEDII VRLHKLIGNR WSLIAGRLPG RTDNEVKNYW NTHLSKRLQK 120 HVTRPIKRRS SSKNSAAVYA PKPLRVTNHQ QPMNTMALAE ATEFVEKLCD NDIDVFDSDA 180 AMCIDGSLQT LYEEYTRLLM PHSTMMMQYS STNVGLHA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 9e-25 | 14 | 118 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 123 | 128 | RPIKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010559136.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010559136.1 | 1e-163 | PREDICTED: transcription factor MYB12-like | ||||
Swissprot | O22264 | 9e-58 | MYB12_ARATH; Transcription factor MYB12 | ||||
TrEMBL | A0A0B0MDX8 | 3e-69 | A0A0B0MDX8_GOSAR; Transcription factor MYB3-like protein | ||||
STRING | XP_010559136.1 | 1e-162 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47460.1 | 4e-60 | myb domain protein 12 |