PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010555639.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 214aa MW: 24956.8 Da PI: 9.7173 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.7 | 9.6e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaevavi+fs++g+lye+ss XP_010555639.1 9 KRIENVTSRQVTFSKRRNGLLKKAHELSVLCDAEVAVIVFSQKGRLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 67.4 | 4.7e-23 | 86 | 171 | 13 | 98 |
K-box 13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++l+ e+ + k+ie L+ qR+l+G+dL+s+s++eL+++ +q+eksl +Rs+K +l+ +q+e+l+ ke+el ee +Lr k+ XP_010555639.1 86 YVQKLRGEMVGMVKKIELLEIHQRKLMGQDLSSCSMEELHEIASQIEKSLHIVRSRKAQLYEDQLEKLKAKERELLEERARLRIKY 171 5688889999999*********************************************************************9887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.744 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.5E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.75E-32 | 3 | 74 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.50E-42 | 3 | 74 | No hit | No description |
Pfam | PF00319 | 7.3E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.761 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 7.1E-23 | 88 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MVRGKIEIKR IENVTSRQVT FSKRRNGLLK KAHELSVLCD AEVAVIVFSQ KGRLYEFSSS 60 DMQKTVQRYG RYTKEFVPET FDVERYVQKL RGEMVGMVKK IELLEIHQRK LMGQDLSSCS 120 MEELHEIASQ IEKSLHIVRS RKAQLYEDQL EKLKAKEREL LEERARLRIK YGEGRWTMFE 180 TEQRDKAAAT GCGGGRRTPE VETDLFIGLP ENRL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6byy_A | 2e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 2e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 2e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 2e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 2e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010555639.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010555639.1 | 1e-155 | PREDICTED: MADS-box protein AGL72-like | ||||
Swissprot | Q9FLH5 | 3e-88 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | A0A178UL76 | 7e-88 | A0A178UL76_ARATH; AGL72 | ||||
STRING | XP_010555639.1 | 1e-155 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 3e-79 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|