PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010555639.1

Organism

Tarenaya hassleriana

Taxonomic ID

28532

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya

Family

MIKC_MADS

Protein Properties

Length: 214aa MW: 24956.8 Da PI: 9.7173

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010555639.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	96.7	9.6e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaevavi+fs++g+lye+ss XP_010555639.1 9 KRIENVTSRQVTFSKRRNGLLKKAHELSVLCDAEVAVIVFSQKGRLYEFSS 59 79***********************************************96 PP
2	K-box	67.4	4.7e-23	86	171	13	98
K-box 13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++l+ e+ + k+ie L+ qR+l+G+dL+s+s++eL+++ +q+eksl +Rs+K +l+ +q+e+l+ ke+el ee +Lr k+ XP_010555639.1 86 YVQKLRGEMVGMVKKIELLEIHQRKLMGQDLSSCSMEELHEIASQIEKSLHIVRSRKAQLYEDQLEKLKAKERELLEERARLRIKY 171 5688889999999*********************************************************************9887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.744	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.5E-41	1	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-31	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.75E-32	3	74	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.50E-42	3	74	No hit	No description
Pfam	PF00319	7.3E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-31	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	13.761	87	177	IPR002487	Transcription factor, K-box
Pfam	PF01486	7.1E-23	88	170	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009909	Biological Process	regulation of flower development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 214 aa Download sequence Send to blast
MVRGKIEIKR IENVTSRQVT FSKRRNGLLK KAHELSVLCD AEVAVIVFSQ KGRLYEFSSS 60 DMQKTVQRYG RYTKEFVPET FDVERYVQKL RGEMVGMVKK IELLEIHQRK LMGQDLSSCS 120 MEELHEIASQ IEKSLHIVRS RKAQLYEDQL EKLKAKEREL LEERARLRIK YGEGRWTMFE 180 TEQRDKAAAT GCGGGRRTPE VETDLFIGLP ENRL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
1tqe_R	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
1tqe_S	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
6byy_A	2e-20	1	73	1	73	MEF2 CHIMERA
6byy_B	2e-20	1	73	1	73	MEF2 CHIMERA
6byy_C	2e-20	1	73	1	73	MEF2 CHIMERA
6byy_D	2e-20	1	73	1	73	MEF2 CHIMERA
6bz1_A	2e-20	1	73	1	73	MEF2 CHIMERA
6bz1_B	2e-20	1	73	1	73	MEF2 CHIMERA
6bz1_C	2e-20	1	73	1	73	MEF2 CHIMERA
6bz1_D	2e-20	1	73	1	73	MEF2 CHIMERA
6c9l_A	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
6c9l_B	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
6c9l_C	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
6c9l_D	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
6c9l_E	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
6c9l_F	2e-20	1	73	1	73	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269\|PubMed:21609362}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010555639.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010555639.1	1e-155	PREDICTED: MADS-box protein AGL72-like
Swissprot	Q9FLH5	3e-88	AGL72_ARATH; MADS-box protein AGL72
TrEMBL	A0A178UL76	7e-88	A0A178UL76_ARATH; AGL72
STRING	XP_010555639.1	1e-155	(Tarenaya hassleriana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G51860.2	3e-79	MIKC_MADS family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]